Protein

Protein accession
3dU8I [EnVhog]
Representative
66qoq
Source
EnVhog (cluster: phalp2_11194)
Protein name
3dU8I
Lysin probability
87%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKANQTLIASDGYEVALFPMPYLYMTQDEGGSYSHYNTYNIDLIGYNGSRVITRAPLYAPCTMKVVNYMPSYSGGHGVTFESTRKVHLPNGRLDYLTILFMHDNSPPYTKVGTVVKQGQLCYRTGTYGYVTGDHVHTCVGQGHWQGLIQRSGGNWDLANRIHYWSGVYVNDTKIIVGYSHNWKKYNGGSPSPTPTPTPSGTTPKRDKFPWVIARAHWPNFKR
Physico‐chemical
properties
protein length:222 AA
molecular weight:25023,0 Da
isoelectric point:9,39
hydropathy:-0,53
Representative Protein Details
Accession
66qoq
Protein name
66qoq
Sequence length
229 AA
Molecular weight
25829,38920 Da
Isoelectric point
5,38336
Sequence
MKYLETSVGSNGKQNVLFPLEYMYITQGENGGYSHQGSYSMDFVGYNASGVVLNAPYYAPCDLTLVYITGSSDALVWQSNDEVNFIDGTTDYICFEFGHDDNIPNYKVGDTKKQGQVIGHTGTRGNVTGDHVHMTIVKGKYAGYYKNSYGIWCLVNQYHLYNGVGVNDTNIINGYGYDWKKWDDSPSPPDPPDPPDPPDPPEPPLPPITFKNFNHFPFYMYKKNNIKRR
Other Proteins in cluster: phalp2_11194
Total (incl. this protein): 192 Avg length: 212,5 Avg pI: 6,40

Protein ID Length (AA) pI
66qoq 229 5,38336
1Gqvl 209 6,17484
1LItk 176 7,72183
1gAMj 212 5,77464
1gII6 224 5,51494
1gJWY 210 5,51272
1gOni 214 6,48484
1gxr7 230 6,10084
1gyDj 224 5,94152
1gyHY 207 6,03598
1gyIF 214 5,93742
1gyp4 168 8,29658
1mM1O 190 5,57297
21kam 217 4,46609
21oji 209 4,37725
21xNq 216 6,21287
23Cbk 217 6,77222
23M6U 220 6,01535
23Re9 210 5,84017
23b3h 217 5,30293
23q6s 209 4,37725
23qHF 213 5,03505
23tWK 196 4,98651
23tjv 214 5,70620
23vRz 219 5,81255
23z6i 224 6,02285
24DSW 217 5,30293
24MBE 208 5,01891
24l1i 221 5,84290
24qIH 219 5,71530
2UtFu 165 5,72996
2my6A 214 6,62682
2o7f3 180 4,93251
2oAox 213 6,88163
2ociX 225 5,47674
38Jjh 212 5,73138
38K8M 226 5,69404
39ziT 178 6,36167
3LhAL 212 6,35604
3TFBw 223 5,48044
3TFBy 213 5,35585
3TGD0 212 6,21360
3TKpr 221 6,11254
3TN4i 216 5,77617
3VLvy 209 6,45665
3WIh5 207 6,03604
3WKXZ 213 5,93197
3WLqo 211 5,56138
3WMBh 211 7,75820
3ZSWw 206 7,65220
3caSt 211 6,20650
3caeJ 210 5,84984
3dNZw 233 7,07568
3dPHc 232 5,71848
3dQAW 219 6,81979
3dSt8 210 5,08319
3dUE4 208 6,68895
3dXke 213 5,84017
3gdxl 216 8,51932
3gfXg 212 5,38034
3h4ex 206 6,81792
3iyhv 224 6,85560
3kQKA 212 5,93327
3nJGD 204 8,56187
3tGOR 220 5,61350
40Xt2 247 7,15923
41j4N 210 6,01575
41jb6 224 5,18107
41kTp 212 6,69509
41lg2 213 5,83329
41oOe 219 6,02808
41oav 212 7,60053
41qfv 210 5,38876
45eB2 225 5,80880
4L70n 200 6,20826
5KWtH 212 6,35314
5MII2 210 6,01893
5Mq7q 214 7,53267
5OsH6 208 6,01080
5P6Fh 210 5,83864
5RQb3 214 7,99049
5Rwne 214 6,35314
5SGCX 214 6,56771
5TXzc 214 6,35314
5UUo4 212 6,35314
5VUYp 212 6,35314
5We2N 214 6,62876
5Y6Rt 212 7,00452
5ZKI9 212 6,35314
5ZlCL 209 6,53389
5l98 221 6,11539
5nxL 234 8,55039
603Yl 212 7,49777
60V0C 214 7,00480
60VJg 228 6,10845
61DiI 214 8,26744
61NIv 214 6,35610
61eI7 214 6,12795
62204 218 6,53560
63ZId 214 6,35309
64MuE 211 7,01981
64y39 214 7,00406
65z7l 212 6,62864
66K98 212 5,93327
66qos 208 7,02055
67At8 216 6,97002
67kl9 218 6,09924
6cCIh 248 4,70197
6chaO 210 5,81209
6doyH 212 6,62864
6dzcj 212 6,13051
6fUcw 210 5,84148
6fpDV 201 6,93006
6gxPh 214 7,54921
6gxQ2 212 7,00452
6h5YW 204 6,32086
6h5vi 212 6,35314
6hRrO 212 6,35314
6iSLC 214 7,00480
6jFWo 212 7,53443
6ksB1 212 6,35314
6m1eK 214 6,62864
6mo82 201 6,19206
6mpeW 207 5,51420
6mqga 212 6,35314
6mr1P 212 6,16808
6vchO 210 5,65243
6wAB8 211 5,77037
6wLyJ 214 7,53056
6wLzF 212 6,62876
6wcOA 212 7,00452
70AN6 212 6,35314
7DKFk 214 8,92708
7W5p7 212 6,62876
7WJCm 212 6,35496
7WjmW 214 6,35314
7XTFW 214 7,99036
7XUyw 212 7,00406
7XxEq 263 8,47187
7YxnH 208 6,34610
7YyR7 214 6,35314
7YyvL 165 5,00600
7ZDKq 214 6,20809
7ZEU3 212 6,35314
7pdmc 231 7,72183
80Rp0 214 6,62665
812Xo 210 5,50698
81Nct 214 7,00480
82A1a 214 7,00480
82BZu 208 8,43648
82C0Q 224 5,85393
82GAk 214 5,85012
82GSE 208 5,46674
82H6N 212 6,10669
83Vhw 212 7,53039
83nnd 212 5,74440
84OSV 212 6,47683
84m1V 212 6,35314
851Fm 212 6,13306
85jdt 156 6,28806
860bT 212 6,35314
88cD1 212 6,12619
8KKN1 231 4,85629
8brMR 221 5,67949
8dbZs 214 6,62665
8eA6A 212 6,12619
8fBvu 216 6,42056
8fiJb 212 7,00452
8hPF5 214 7,00452
8hQgy 212 6,35314
8hj6H 210 5,93930
8jChn 212 6,35314
8k1cb 209 5,85813
8kYkw 209 6,36752
8ljLc 214 6,62864
8lqD7 210 6,01893
8mZqI 176 4,83458
8miKj 206 7,60775
8mjcx 212 8,19936
8mjq7 224 8,92734
8nwn8 230 9,43690
8oPCB 212 6,35491
8ov3Z 215 7,53454
8pfjq 212 6,35314
8pwEU 212 6,96155
8rh0H 200 5,71712
8smE9 221 5,22449
8vKH8 212 7,99049
a0eq 212 7,57990
a7l9 215 5,83557
wSvu 207 6,12641
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_28632
8fBDU
1 37,8% 227 4.504E-79
2 phalp2_11214
6nAAQ
38 34,4% 229 6.575E-67
3 phalp2_36408
PWlr
18 41,3% 186 2.641E-55
4 phalp2_39979
1KNyb
59 41,5% 178 9.271E-52
5 phalp2_38032
5TEy4
7 37,7% 204 1.737E-51
6 phalp2_36734
6wFxi
48 34,7% 184 2.652E-35
7 phalp2_7144
2GvAs
21 27,8% 194 6.765E-35
8 phalp2_25319
8fvUo
3 26,4% 185 8.726E-27
9 phalp2_35713
3TDiN
29 32,6% 190 2.640E-25
10 phalp2_10424
21qZ3
9 29,6% 155 3.809E-21

Domains

Domains
Unannotated
Disordered region
Representative sequence (used for alignment): 66qoq (229 AA)
Member sequence: 3dU8I (222 AA)
1 229 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (66qoq) rather than this protein.
PDB ID
66qoq
Method AlphaFoldv2
Resolution 88.29
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50