Protein
- Protein accession
- 8dbZs [EnVhog]
- Representative
- 66qoq
- Source
- EnVhog (cluster: phalp2_11194)
- Protein name
- 8dbZs
- Lysin probability
- 87%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MKAGQKMNTDDGKYQVCLFPCDIMNITQLSGSDSFSHCCGHPMDIIGNSARYPLYAPCDCHLIYQDSVGNTRGYQSDNEVATPSGIGYVCFSFTHDENPPSATKFKQGDLISHTGIAGQAYGDHCHLDQAKGQNKGLVSYGITCAMGNPCYALQDSAEPVDIWYINDTTVVSTMGLIFKKYDGGVAPPTPTPTKKGKMKLMYYMKGWNMRYGRF
- Physico‐chemical
properties -
protein length: 214 AA molecular weight: 23522,4 Da isoelectric point: 6,63 hydropathy: -0,41
Representative Protein Details
- Accession
- 66qoq
- Protein name
- 66qoq
- Sequence length
- 229 AA
- Molecular weight
- 25829,38920 Da
- Isoelectric point
- 5,38336
- Sequence
-
MKYLETSVGSNGKQNVLFPLEYMYITQGENGGYSHQGSYSMDFVGYNASGVVLNAPYYAPCDLTLVYITGSSDALVWQSNDEVNFIDGTTDYICFEFGHDDNIPNYKVGDTKKQGQVIGHTGTRGNVTGDHVHMTIVKGKYAGYYKNSYGIWCLVNQYHLYNGVGVNDTNIINGYGYDWKKWDDSPSPPDPPDPPDPPDPPEPPLPPITFKNFNHFPFYMYKKNNIKRR
Other Proteins in cluster: phalp2_11194
| Total (incl. this protein): 192 | Avg length: 212,5 | Avg pI: 6,40 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 66qoq | 229 | 5,38336 |
| 1Gqvl | 209 | 6,17484 |
| 1LItk | 176 | 7,72183 |
| 1gAMj | 212 | 5,77464 |
| 1gII6 | 224 | 5,51494 |
| 1gJWY | 210 | 5,51272 |
| 1gOni | 214 | 6,48484 |
| 1gxr7 | 230 | 6,10084 |
| 1gyDj | 224 | 5,94152 |
| 1gyHY | 207 | 6,03598 |
| 1gyIF | 214 | 5,93742 |
| 1gyp4 | 168 | 8,29658 |
| 1mM1O | 190 | 5,57297 |
| 21kam | 217 | 4,46609 |
| 21oji | 209 | 4,37725 |
| 21xNq | 216 | 6,21287 |
| 23Cbk | 217 | 6,77222 |
| 23M6U | 220 | 6,01535 |
| 23Re9 | 210 | 5,84017 |
| 23b3h | 217 | 5,30293 |
| 23q6s | 209 | 4,37725 |
| 23qHF | 213 | 5,03505 |
| 23tWK | 196 | 4,98651 |
| 23tjv | 214 | 5,70620 |
| 23vRz | 219 | 5,81255 |
| 23z6i | 224 | 6,02285 |
| 24DSW | 217 | 5,30293 |
| 24MBE | 208 | 5,01891 |
| 24l1i | 221 | 5,84290 |
| 24qIH | 219 | 5,71530 |
| 2UtFu | 165 | 5,72996 |
| 2my6A | 214 | 6,62682 |
| 2o7f3 | 180 | 4,93251 |
| 2oAox | 213 | 6,88163 |
| 2ociX | 225 | 5,47674 |
| 38Jjh | 212 | 5,73138 |
| 38K8M | 226 | 5,69404 |
| 39ziT | 178 | 6,36167 |
| 3LhAL | 212 | 6,35604 |
| 3TFBw | 223 | 5,48044 |
| 3TFBy | 213 | 5,35585 |
| 3TGD0 | 212 | 6,21360 |
| 3TKpr | 221 | 6,11254 |
| 3TN4i | 216 | 5,77617 |
| 3VLvy | 209 | 6,45665 |
| 3WIh5 | 207 | 6,03604 |
| 3WKXZ | 213 | 5,93197 |
| 3WLqo | 211 | 5,56138 |
| 3WMBh | 211 | 7,75820 |
| 3ZSWw | 206 | 7,65220 |
| 3caSt | 211 | 6,20650 |
| 3caeJ | 210 | 5,84984 |
| 3dNZw | 233 | 7,07568 |
| 3dPHc | 232 | 5,71848 |
| 3dQAW | 219 | 6,81979 |
| 3dSt8 | 210 | 5,08319 |
| 3dU8I | 222 | 9,38507 |
| 3dUE4 | 208 | 6,68895 |
| 3dXke | 213 | 5,84017 |
| 3gdxl | 216 | 8,51932 |
| 3gfXg | 212 | 5,38034 |
| 3h4ex | 206 | 6,81792 |
| 3iyhv | 224 | 6,85560 |
| 3kQKA | 212 | 5,93327 |
| 3nJGD | 204 | 8,56187 |
| 3tGOR | 220 | 5,61350 |
| 40Xt2 | 247 | 7,15923 |
| 41j4N | 210 | 6,01575 |
| 41jb6 | 224 | 5,18107 |
| 41kTp | 212 | 6,69509 |
| 41lg2 | 213 | 5,83329 |
| 41oOe | 219 | 6,02808 |
| 41oav | 212 | 7,60053 |
| 41qfv | 210 | 5,38876 |
| 45eB2 | 225 | 5,80880 |
| 4L70n | 200 | 6,20826 |
| 5KWtH | 212 | 6,35314 |
| 5MII2 | 210 | 6,01893 |
| 5Mq7q | 214 | 7,53267 |
| 5OsH6 | 208 | 6,01080 |
| 5P6Fh | 210 | 5,83864 |
| 5RQb3 | 214 | 7,99049 |
| 5Rwne | 214 | 6,35314 |
| 5SGCX | 214 | 6,56771 |
| 5TXzc | 214 | 6,35314 |
| 5UUo4 | 212 | 6,35314 |
| 5VUYp | 212 | 6,35314 |
| 5We2N | 214 | 6,62876 |
| 5Y6Rt | 212 | 7,00452 |
| 5ZKI9 | 212 | 6,35314 |
| 5ZlCL | 209 | 6,53389 |
| 5l98 | 221 | 6,11539 |
| 5nxL | 234 | 8,55039 |
| 603Yl | 212 | 7,49777 |
| 60V0C | 214 | 7,00480 |
| 60VJg | 228 | 6,10845 |
| 61DiI | 214 | 8,26744 |
| 61NIv | 214 | 6,35610 |
| 61eI7 | 214 | 6,12795 |
| 62204 | 218 | 6,53560 |
| 63ZId | 214 | 6,35309 |
| 64MuE | 211 | 7,01981 |
| 64y39 | 214 | 7,00406 |
| 65z7l | 212 | 6,62864 |
| 66K98 | 212 | 5,93327 |
| 66qos | 208 | 7,02055 |
| 67At8 | 216 | 6,97002 |
| 67kl9 | 218 | 6,09924 |
| 6cCIh | 248 | 4,70197 |
| 6chaO | 210 | 5,81209 |
| 6doyH | 212 | 6,62864 |
| 6dzcj | 212 | 6,13051 |
| 6fUcw | 210 | 5,84148 |
| 6fpDV | 201 | 6,93006 |
| 6gxPh | 214 | 7,54921 |
| 6gxQ2 | 212 | 7,00452 |
| 6h5YW | 204 | 6,32086 |
| 6h5vi | 212 | 6,35314 |
| 6hRrO | 212 | 6,35314 |
| 6iSLC | 214 | 7,00480 |
| 6jFWo | 212 | 7,53443 |
| 6ksB1 | 212 | 6,35314 |
| 6m1eK | 214 | 6,62864 |
| 6mo82 | 201 | 6,19206 |
| 6mpeW | 207 | 5,51420 |
| 6mqga | 212 | 6,35314 |
| 6mr1P | 212 | 6,16808 |
| 6vchO | 210 | 5,65243 |
| 6wAB8 | 211 | 5,77037 |
| 6wLyJ | 214 | 7,53056 |
| 6wLzF | 212 | 6,62876 |
| 6wcOA | 212 | 7,00452 |
| 70AN6 | 212 | 6,35314 |
| 7DKFk | 214 | 8,92708 |
| 7W5p7 | 212 | 6,62876 |
| 7WJCm | 212 | 6,35496 |
| 7WjmW | 214 | 6,35314 |
| 7XTFW | 214 | 7,99036 |
| 7XUyw | 212 | 7,00406 |
| 7XxEq | 263 | 8,47187 |
| 7YxnH | 208 | 6,34610 |
| 7YyR7 | 214 | 6,35314 |
| 7YyvL | 165 | 5,00600 |
| 7ZDKq | 214 | 6,20809 |
| 7ZEU3 | 212 | 6,35314 |
| 7pdmc | 231 | 7,72183 |
| 80Rp0 | 214 | 6,62665 |
| 812Xo | 210 | 5,50698 |
| 81Nct | 214 | 7,00480 |
| 82A1a | 214 | 7,00480 |
| 82BZu | 208 | 8,43648 |
| 82C0Q | 224 | 5,85393 |
| 82GAk | 214 | 5,85012 |
| 82GSE | 208 | 5,46674 |
| 82H6N | 212 | 6,10669 |
| 83Vhw | 212 | 7,53039 |
| 83nnd | 212 | 5,74440 |
| 84OSV | 212 | 6,47683 |
| 84m1V | 212 | 6,35314 |
| 851Fm | 212 | 6,13306 |
| 85jdt | 156 | 6,28806 |
| 860bT | 212 | 6,35314 |
| 88cD1 | 212 | 6,12619 |
| 8KKN1 | 231 | 4,85629 |
| 8brMR | 221 | 5,67949 |
| 8eA6A | 212 | 6,12619 |
| 8fBvu | 216 | 6,42056 |
| 8fiJb | 212 | 7,00452 |
| 8hPF5 | 214 | 7,00452 |
| 8hQgy | 212 | 6,35314 |
| 8hj6H | 210 | 5,93930 |
| 8jChn | 212 | 6,35314 |
| 8k1cb | 209 | 5,85813 |
| 8kYkw | 209 | 6,36752 |
| 8ljLc | 214 | 6,62864 |
| 8lqD7 | 210 | 6,01893 |
| 8mZqI | 176 | 4,83458 |
| 8miKj | 206 | 7,60775 |
| 8mjcx | 212 | 8,19936 |
| 8mjq7 | 224 | 8,92734 |
| 8nwn8 | 230 | 9,43690 |
| 8oPCB | 212 | 6,35491 |
| 8ov3Z | 215 | 7,53454 |
| 8pfjq | 212 | 6,35314 |
| 8pwEU | 212 | 6,96155 |
| 8rh0H | 200 | 5,71712 |
| 8smE9 | 221 | 5,22449 |
| 8vKH8 | 212 | 7,99049 |
| a0eq | 212 | 7,57990 |
| a7l9 | 215 | 5,83557 |
| wSvu | 207 | 6,12641 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_28632
8fBDU
|
1 | 37,8% | 227 | 4.504E-79 |
| 2 |
phalp2_11214
6nAAQ
|
38 | 34,4% | 229 | 6.575E-67 |
| 3 |
phalp2_36408
PWlr
|
18 | 41,3% | 186 | 2.641E-55 |
| 4 |
phalp2_39979
1KNyb
|
59 | 41,5% | 178 | 9.271E-52 |
| 5 |
phalp2_38032
5TEy4
|
7 | 37,7% | 204 | 1.737E-51 |
| 6 |
phalp2_36734
6wFxi
|
48 | 34,7% | 184 | 2.652E-35 |
| 7 |
phalp2_7144
2GvAs
|
21 | 27,8% | 194 | 6.765E-35 |
| 8 |
phalp2_25319
8fvUo
|
3 | 26,4% | 185 | 8.726E-27 |
| 9 |
phalp2_35713
3TDiN
|
29 | 32,6% | 190 | 2.640E-25 |
| 10 |
phalp2_10424
21qZ3
|
9 | 29,6% | 155 | 3.809E-21 |
Domains
Domains
1
229 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(66qoq)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50