Protein
- Protein accession
- 1f96G [EnVhog]
- Representative
- 2mvmf
- Source
- EnVhog (cluster: phalp2_4390)
- Protein name
- 1f96G
- Lysin probability
- 91%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
LVEIEGIYMIGIDISENNANLDWQAIKDYGTELVVVRAGYGQGHEDSMFYKYAAKATEEGYQLSAYWFSYALTVEQAAAEGYYCRQLIDSSGLGFNDIWFDMEDTAYRQNNGFDYNDVATNTAMCDAFFDSLQLSSVGVYANPDWFTNVIDYGYLRDRYKIWLAEYNSSASFGYDMWQYGIRQIGGVDIDCNIT
- Physico‐chemical
properties -
protein length: 194 AA molecular weight: 22147,1 Da isoelectric point: 4,05 hydropathy: -0,27
Representative Protein Details
- Accession
- 2mvmf
- Protein name
- 2mvmf
- Sequence length
- 145 AA
- Molecular weight
- 16014,91730 Da
- Isoelectric point
- 8,66824
- Sequence
-
MAIKGIDVSVWQGNIDFGKVKVSGINFVIIRAGYGNGNKDKWFDENYRKAKAAGLHIGAYWYSYATSADGAKQEAQSCAKVLSGKQLDYPVYFDIEEKSQLSRGKDFCSSLITAFCTELERLGYYAGFYTSLSSLNSVISDAVKK
Other Proteins in cluster: phalp2_4390
| Total (incl. this protein): 118 | Avg length: 205,6 | Avg pI: 6,84 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 2mvmf | 145 | 8,66824 |
| 1jFSi | 155 | 6,71066 |
| 1jT7v | 199 | 7,58161 |
| 23JaM | 171 | 8,43403 |
| 23iUj | 144 | 4,94820 |
| 2Ai6 | 123 | 8,41959 |
| 30EXK | 187 | 8,84663 |
| 3LP3E | 132 | 6,13187 |
| 3TQ6u | 122 | 4,72726 |
| 3VFxB | 157 | 5,12565 |
| 3VHxc | 153 | 6,10146 |
| 3VLVA | 317 | 8,80369 |
| 3WFd7 | 156 | 5,54336 |
| 3k3ye | 111 | 5,81539 |
| 3kpQc | 267 | 7,78380 |
| 3kri7 | 144 | 8,95764 |
| 3l2Jb | 272 | 9,73732 |
| 3lKTk | 132 | 6,57681 |
| 3mawn | 132 | 5,03721 |
| 3mhY6 | 235 | 6,83963 |
| 3onR2 | 265 | 6,91562 |
| 3sQPq | 189 | 4,14211 |
| 3tAzL | 167 | 8,16294 |
| 3tn8E | 197 | 5,41502 |
| 3tsgg | 127 | 9,16220 |
| 3txxu | 143 | 5,75122 |
| 3tyke | 155 | 9,01805 |
| 3u3R7 | 267 | 5,76253 |
| 3uRMK | 286 | 8,30445 |
| 3uiWF | 173 | 9,08535 |
| 3v0eM | 285 | 8,49476 |
| 3vOk8 | 134 | 8,83567 |
| 3wrmh | 111 | 5,81539 |
| 3xQWx | 134 | 9,06227 |
| 3xXtz | 111 | 6,56709 |
| 3yrjo | 263 | 7,74536 |
| 40CBw | 258 | 8,81239 |
| 4LaQ0 | 241 | 5,06870 |
| 4MiOY | 124 | 4,81616 |
| 4yy9u | 262 | 8,72065 |
| 5HJ71 | 189 | 4,11932 |
| 5HJXK | 191 | 4,05003 |
| 5JYYE | 187 | 5,16805 |
| 5KxRM | 261 | 5,64703 |
| 5Mrcm | 188 | 4,23316 |
| 5Nc7t | 281 | 7,02191 |
| 5ONoV | 262 | 5,87104 |
| 5PTbK | 281 | 7,76940 |
| 5QoLo | 261 | 5,86967 |
| 5QzJT | 260 | 5,53904 |
| 5RoHN | 281 | 8,49476 |
| 5U5dL | 211 | 5,61611 |
| 5ULOd | 261 | 5,76975 |
| 5UuLf | 261 | 6,08259 |
| 5VcAZ | 126 | 4,05003 |
| 5VqSh | 262 | 5,57587 |
| 5WXKY | 262 | 5,97482 |
| 5ZpbJ | 119 | 4,72135 |
| 5ou7C | 141 | 4,26045 |
| 5tD8T | 200 | 8,87428 |
| 614h2 | 232 | 8,57534 |
| 61x35 | 261 | 5,29315 |
| 62Kyn | 267 | 6,66672 |
| 62U9X | 160 | 8,33101 |
| 63JjM | 262 | 6,97155 |
| 68P2v | 147 | 9,03758 |
| 69Ema | 191 | 5,59349 |
| 69Tg6 | 188 | 5,94351 |
| 6ZfgM | 178 | 9,47113 |
| 6bl0t | 261 | 5,87069 |
| 6bmrE | 262 | 6,30898 |
| 6eFBr | 265 | 6,91562 |
| 6ejK2 | 157 | 4,61194 |
| 6eprB | 168 | 8,67753 |
| 6fflD | 261 | 5,97619 |
| 6g6p6 | 185 | 5,25331 |
| 6gcsC | 237 | 8,56690 |
| 6hByR | 142 | 9,23589 |
| 6hXKt | 220 | 5,55058 |
| 6jmGF | 195 | 9,04287 |
| 6kK7S | 262 | 7,02129 |
| 6lRQX | 125 | 8,48773 |
| 6mB5E | 171 | 4,16678 |
| 6nFRu | 281 | 8,49476 |
| 6nXMa | 186 | 6,29164 |
| 6njwe | 233 | 6,74062 |
| 6npmi | 272 | 9,72533 |
| 6oEFS | 261 | 5,69455 |
| 6oPLg | 262 | 5,69836 |
| 6os3v | 262 | 6,07657 |
| 6pddW | 188 | 5,49243 |
| 6qF8d | 153 | 9,04209 |
| 6r7gT | 258 | 6,53151 |
| 6sehV | 258 | 8,93585 |
| 6tJN7 | 262 | 5,88201 |
| 6uWCX | 261 | 5,69626 |
| 6vSMk | 265 | 5,98398 |
| 76tpy | 146 | 9,41988 |
| 7MsbT | 267 | 6,16938 |
| 7Nq5t | 155 | 7,75292 |
| 7UICd | 269 | 5,12855 |
| 7Y6Ym | 111 | 5,81539 |
| 7sAQi | 171 | 4,08322 |
| 8g4zl | 138 | 9,44747 |
| 8jHYn | 266 | 6,97007 |
| 8jT4j | 158 | 8,63040 |
| 8klFt | 285 | 8,92483 |
| F688 | 271 | 9,73732 |
| NPrl | 144 | 6,90761 |
| NU3H | 128 | 4,97156 |
| mYma | 118 | 8,64394 |
| oePX | 222 | 5,20778 |
| oqdn | 315 | 8,06198 |
| osqO | 150 | 5,73604 |
| ww70 | 152 | 6,71663 |
| xs8w | 263 | 8,62975 |
| A0A7T7ZAG9 | 306 | 6,74215 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_14273
3kLGA
|
7 | 40,7% | 140 | 1.029E-43 |
| 2 |
phalp2_24879
a1g4
|
16 | 43,5% | 131 | 1.604E-41 |
| 3 |
phalp2_10753
3yWC4
|
1 | 33,8% | 139 | 1.329E-39 |
| 4 |
phalp2_5668
4yhqW
|
7 | 40,9% | 144 | 4.274E-38 |
| 5 |
phalp2_11218
6q99m
|
1 | 34,7% | 141 | 1.101E-37 |
| 6 |
phalp2_25924
66tGM
|
6 | 53,5% | 99 | 1.374E-36 |
| 7 |
phalp2_29946
8mgNr
|
1 | 41,4% | 135 | 1.883E-36 |
| 8 |
phalp2_3380
3qQTc
|
8 | 44,8% | 98 | 4.851E-36 |
| 9 |
phalp2_5939
6bh0H
|
94 | 35,9% | 142 | 2.928E-34 |
| 10 |
phalp2_34287
3mtX2
|
6 | 44,2% | 95 | 6.231E-32 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(2mvmf)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50