Protein

Protein accession
1eWRm [EnVhog]
Representative
7R5SF
Source
EnVhog (cluster: phalp2_40627)
Protein name
1eWRm
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MLTAPQLRAATGCTAARADDWLPHIIKSCETFAINTPARLVCYLPQIGHESGRLAYVREIWGPTPAQQRYEGRADLGNTQPGDGKRYMGRGLIQTTGRANYRATCDGLAAYLPNVPDLEAFPALLERPDLAAMSAAWFWHSRELNTFADLGDFIRITKRINGGTNGLADRLALYEAAKAVLL
Physico‐chemical
properties
protein length:182 AA
molecular weight:19975,6 Da
isoelectric point:8,39
hydropathy:-0,22
Representative Protein Details
Accession
7R5SF
Protein name
7R5SF
Sequence length
172 AA
Molecular weight
N/A Da
Isoelectric point
9,78909
Sequence
MPITEQQLLQILSSAGPRAGIFLPALNAAMDKYGIAGRLRVAAFIAQVGHESGQLRWLREIWGPTPTQAGYEGRKDLGNTQPGDGSKYRGRGLIQITGRANYESCGKALGLDLIAAPELLEHXXXXLVARNLGADPSAGWLRGPKRPWQHSPVRRLEIPWARADSNYWTCKL
Other Proteins in cluster: phalp2_40627
Total (incl. this protein): 154 Avg length: 185,9 Avg pI: 8,71

Protein ID Length (AA) pI
7R5SF 172 9,78909
11hA7 144 11,45399
11hUu 185 9,01528
11oad 182 9,17761
19UM6 175 8,03039
1Gw9w 181 9,78844
1GzdP 182 9,02746
1HZbd 233 10,21742
1I02E 182 8,48941
1KvK6 176 9,42259
1Lw7i 225 9,03874
1NByI 190 6,42573
1NUdE 187 9,65493
1OMbZ 182 9,38075
1XzCf 179 5,31447
1bCYX 203 9,79953
1bD1n 203 9,85246
1bpRV 202 6,76119
1eWRY 182 8,50411
1gPn0 185 9,31815
1go3s 194 8,69216
1j59Y 185 5,48982
1j6pZ 205 5,45463
1oNI1 187 9,02449
1oNlq 151 8,81517
2AXOo 188 9,96393
2AYgN 188 10,28511
2LBc8 176 9,60432
2SZsh 188 9,59568
2UstF 181 8,70873
2UuwG 177 9,41001
2V6Ue 191 6,83366
2Xkb4 176 9,43890
2cJEc 214 8,68610
2jGNQ 185 9,24207
2lL9Y 180 5,88138
2lLza 180 5,66283
2shdT 187 9,41182
2tEqb 174 9,49486
2wJH4 185 9,24923
35fuU 203 8,66405
3OA6K 232 9,13751
3fEdc 192 5,80198
3gGcm 206 8,92882
3i8f 191 9,16729
45b1m 201 6,49524
4DGlR 182 8,51932
4GoEI 182 7,01987
4KB6l 184 6,40492
4KuKE 198 9,94220
4MC4L 207 8,29052
4MIpn 184 6,04729
4MOU4 134 9,02778
4MyG6 183 6,40856
4MzMo 168 9,41588
4N191 192 9,86742
4QtYH 173 7,78406
4Ttfm 184 5,77293
4Xu2f 203 9,62096
4Yjez 176 9,69226
4dSxm 178 4,90631
4jNhD 183 6,73595
4jjQQ 193 6,06935
4pUu7 191 9,73210
4uDoL 205 6,62722
4w3qT 178 6,13852
5AGkE 130 10,52848
5EX8U 184 6,33734
5H6Hj 183 6,28443
5IGgp 191 10,54292
5y025 181 9,41627
6DMI6 223 7,84614
6DpGd 191 8,56413
6DwTy 151 9,45688
6EkwW 175 6,82207
6F7pL 185 8,66444
6H9sE 175 5,40638
6IwQU 190 10,44937
6KsU2 188 8,30844
6ObEZ 175 6,89925
6PQib 193 9,71914
6Phm6 171 9,73622
6RBjc 221 6,73794
6RwbQ 216 8,68545
6Rwiw 215 7,82512
6SiXg 176 9,35876
6SkLj 154 9,84872
6SuDE 188 9,59568
6Tq2u 175 9,56583
6WVoZ 203 9,91132
6aV9Y 178 9,23382
6x4N3 201 8,57986
72Lda 183 9,46146
7566l 187 9,49357
757OA 181 9,34948
76nQn 182 9,56822
77VH 188 9,59407
79vqB 182 9,58769
7ASZx 178 8,65883
7BDsU 181 9,56828
7Bict 183 9,42220
7IzTb 173 9,45733
7LBhW 181 9,49750
7WPHc 197 9,65622
7aLAT 182 10,13516
7bfAU 187 9,59568
7cI94 177 7,77469
7cJHn 185 9,98797
7dNcT 181 8,76037
7dbz6 191 9,96393
7dhAH 181 9,55655
7iVWE 203 9,79953
7kQaM 183 9,42213
7sEKE 200 9,59807
7tXHI 187 9,49357
7tXMt 182 10,09177
7taov 185 9,85536
7vOom 182 9,05840
7wJQe 187 9,02385
7whXu 210 6,59647
7wjd8 183 9,42213
7yqRR 205 9,99191
7z3LH 181 7,13974
7z4Mg 187 9,82384
80xw8 185 9,29262
877xa 180 5,31509
89iuD 178 9,62508
8HmRZ 178 6,42618
8a8KJ 176 9,57260
8aRaO 189 10,23134
8evMC 177 9,44837
8fpbn 176 9,63572
8iH0i 179 6,15978
8iVZq 189 10,23134
8lR3b 204 9,71089
8nZfG 176 9,60297
8om2R 176 9,67169
8oqPm 176 9,48667
8rToq 197 9,65628
8tAGf 175 9,35025
8tXvF 176 9,44599
QdMk 183 7,84807
blsj 176 7,79998
bsgg 185 8,85333
cGqK 187 9,49369
gASC 182 10,30451
gU7V 181 8,97298
nUEy 191 9,45630
sD1P 199 9,05583
t3BW 225 9,17728
A0A059VA40 177 9,16336
A0A6M3TDJ6 177 9,09638
A0A6M3TDY4 177 9,09638
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_1654
8rD3A
4011 57,6% 156 4.240E-62
2 phalp2_23254
4Uvr8
48 51,9% 156 1.921E-57
3 phalp2_22262
7pbAz
301 58,0% 131 1.796E-53
4 phalp2_82
4Uvd5
73 43,8% 171 8.094E-49
5 phalp2_17227
3zUSo
139 46,2% 147 1.136E-45
6 phalp2_8404
IwNf
80 53,2% 124 1.281E-43
7 phalp2_37433
2Fv3r
11643 38,3% 167 1.072E-38
8 phalp2_36134
6NUh4
42 36,8% 171 7.081E-38
9 phalp2_5234
8cPFI
3482 35,3% 184 6.408E-37
10 phalp2_12287
7e8ZJ
95 36,7% 155 7.177E-35

Domains

Domains
Unannotated
Disordered region
Representative sequence (used for alignment): 7R5SF (172 AA)
Member sequence: 1eWRm (182 AA)
1 172 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (7R5SF) rather than this protein.
PDB ID
7R5SF
Method AlphaFoldv2
Resolution 67.97
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50