Protein

Protein accession
1csGY [EnVhog]
Representative
7bfSL
Source
EnVhog (cluster: phalp2_3939)
Protein name
1csGY
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
LIREIKKDFLTVNPYSRCGKKLRGVKGVVIHWTGNPGTSAQANRNYFESLKDQTGNEGVRYASAHFVVGIDGEIIQCLPLDEWAYHVGAKKYVEGIQEKLGAIPNSCTIGIEMCHPTWHGHFTNATWEAAAELTAVLLKRFNLCPDKDVYRHYDITGKICPKWFVERASEWRRFLCDVEQNLKEIL
Physico‐chemical
properties
protein length:186 AA
molecular weight:21210,1 Da
isoelectric point:8,17
hydropathy:-0,34
Representative Protein Details
Accession
7bfSL
Protein name
7bfSL
Sequence length
207 AA
Molecular weight
23620,97430 Da
Isoelectric point
8,87370
Sequence
MKITEMLLTPSLYNRQQTKINVTKIAVHYVGNPNSTALANRNYFESLSKSRTTKASSHYIIGLQGEIIRCIPEKEQSICTNSANPYSISIECCHPDTTGKFKETTYNALIELCADICRRYNLNPLADIIRHYDVTGKICPKWFVDNPKEWEVFRNKVNVAIEMTFEEALKIVAEKVDTSYKFWLGKRDIDPSFPALIIKIAKSYGGK
Other Proteins in cluster: phalp2_3939
Total (incl. this protein): 153 Avg length: 235,4 Avg pI: 8,16

Protein ID Length (AA) pI
7bfSL 207 8,87370
136NT 239 6,75608
13EGi 241 8,90065
13IUx 180 8,68720
13cIN 239 6,79205
14yFs 266 9,16362
16S5N 249 8,95313
1AQPY 248 8,94739
1E6m7 219 6,12869
1H2MW 255 9,19463
1HKvr 261 8,95255
1LESv 198 6,19036
1LG56 197 8,14901
1a8XU 273 5,02982
1cqaJ 184 7,70318
1cuux 184 9,17071
1dn8d 226 8,43551
1dugi 267 4,89363
1fR3V 222 7,23006
1g0ed 251 8,24314
1g0fJ 250 6,18570
1jVk1 184 8,78725
1kj1F 262 9,20468
1kpWv 184 8,78725
1laAF 260 8,94197
1njFi 247 9,13229
1njWo 246 9,13216
1rc9J 205 8,10434
23sUT 193 7,76457
25m8v 175 6,22884
2G5RL 251 8,87622
2G5Wf 279 8,70679
2Npas 186 8,81336
2V4Mg 243 5,10229
2VCbD 246 8,36311
2VCi1 246 7,60730
2XyNC 180 8,94030
2auD8 329 8,69345
2v9td 189 6,24259
3PF2I 275 9,52715
3aqpo 200 6,46949
3aroR 200 7,22517
3cuwG 199 8,43519
3cwxQ 198 8,77526
3fsM4 196 6,95234
3iUOa 219 9,17413
3kPEg 247 8,86751
3lcD5 219 9,17413
3ngFJ 208 6,29108
3p2ML 263 9,08174
3qpt4 263 9,12010
3sq3S 219 9,24530
3tTy1 245 9,02385
3tiPE 246 9,20739
3wXjm 263 9,25000
3wdJM 246 9,21751
3xQpg 326 9,13802
3xRpJ 330 9,23904
41qSe 242 9,76627
4LqOS 248 5,00538
4OHuC 232 8,72233
4PzvM 224 5,87342
4SFP1 330 9,31583
4SFY0 326 9,11443
4USy4 199 6,69884
4ZHeI 248 8,85385
4ZO4m 248 6,42067
4g6yQ 187 5,68529
4hTuV 243 5,69000
4hU05 250 5,50118
4hwaP 225 7,65680
4iwtR 233 8,99806
4kQ7Q 253 8,79299
4tJ6A 251 7,99326
4xvW4 220 7,01390
4xwAO 260 6,09731
4xwFQ 220 6,25652
4xwGT 220 7,64106
4xwGv 249 9,15188
4xwUC 220 6,08543
4xwvD 246 6,46529
4yAa2 250 8,59533
4yBEJ 248 8,11439
4ybZw 289 9,23962
5EJ6u 204 6,23623
5HH6E 329 8,70080
5HLsc 266 8,89575
5KmpI 261 9,41337
5NviF 284 8,82993
5QZpL 246 9,14157
5RKS6 262 9,53728
5RyQX 219 9,17413
5WkIz 258 9,56848
5hUHr 244 6,18433
5i4A4 244 6,66508
5indZ 244 6,25504
5jzlE 306 8,93288
5uk15 180 7,69665
66Jk9 219 9,08838
67b5 223 8,74992
6DZV 210 9,25826
6Ppnf 213 5,64271
6Xpdk 174 8,61937
6Xqbi 280 8,95403
6Xqi0 176 9,32015
6diLt 202 8,77629
6g0EV 263 9,30977
6hiiI 202 8,35518
6iYNd 261 9,47094
6nBex 219 9,10624
6pBE3 261 9,45843
6tWRj 262 9,25000
6tky7 262 9,18702
72X26 184 8,93824
75OmR 261 9,06685
79pfr 202 8,69371
7E9oU 188 6,69043
7KxHW 262 9,25007
7YRSK 187 5,51500
7cUTG 261 8,72710
7oqYy 256 8,47890
7oqZr 256 8,45575
7or0S 255 8,97685
7or0b 255 7,96476
7or2P 255 8,62892
7qcA9 261 8,98614
7r5c1 180 8,66599
7rg9E 253 8,97015
7srcC 258 8,44705
7wCWu 248 9,10843
7wCXY 261 8,83728
7whLR 252 6,66013
80rMq 202 8,54549
84MVB 245 9,23363
87QO0 223 5,21176
8fx6Z 197 5,98977
8gi9f 262 9,25007
8nEah 200 8,58495
8ouIl 261 9,41350
8sEBW 245 9,18218
8vrLM 210 8,06153
91u7 198 8,53557
DNOx 247 8,97176
HKcV 184 8,78725
ZjXy 255 9,13345
dlpm 180 8,73980
f7fr 199 6,37759
mY7M 217 8,70054
n3B3 303 9,08129
qaO3 253 8,96660
umVf 167 7,06460
xpQQ 184 6,94285
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_25288
86peP
187 49,0% 163 1.981E-74
2 phalp2_27786
7skBJ
83 48,4% 188 1.981E-74
3 phalp2_7626
5U1PP
11 51,8% 158 1.878E-67
4 phalp2_11225
6wIAx
104 50,5% 170 3.596E-64
5 phalp2_31879
4GdWf
8 45,2% 157 1.469E-55
6 phalp2_26646
2dQ36
4 32,6% 184 4.227E-53
7 phalp2_10049
7q2PM
57 42,4% 198 7.164E-52
8 phalp2_37528
3iFdV
13 30,9% 181 8.066E-44
9 phalp2_23523
75EkF
74 34,7% 164 3.138E-41
10 phalp2_5052
1q1Q3
64 30,9% 184 2.535E-39

Domains

Domains
Representative sequence (used for alignment): 7bfSL (207 AA)
Member sequence: 1csGY (186 AA)
1 207 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01510

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (7bfSL) rather than this protein.
PDB ID
7bfSL
Method AlphaFoldv2
Resolution 94.68
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50