Protein
- Protein accession
- 1ckJe [EnVhog]
- Representative
- 3ZOXH
- Source
- EnVhog (cluster: phalp2_31753)
- Protein name
- 1ckJe
- Lysin probability
- 96%
- PhaLP type
-
VAL
Probability: 70% (predicted by ML model) - Protein sequence
-
MIEVNDLIGASYKDHGRDKGGYDCYGLCIEVARRAGYRLDDVYYEDHAVALSNLHAPTLNVHKIDAPKEGALLEMETHTEAGTELHLGVCLNETEFIHMTRLGCRVNRIGTFKVRGIYGIDTRL
- Physico‐chemical
properties -
protein length: 124 AA molecular weight: 13892,6 Da isoelectric point: 5,75 hydropathy: -0,28
Representative Protein Details
- Accession
- 3ZOXH
- Protein name
- 3ZOXH
- Sequence length
- 128 AA
- Molecular weight
- 14556,70020 Da
- Isoelectric point
- 6,95234
- Sequence
-
MIYYEDLLNVPYKPHGRTPQEGFDCIGLPIFCVKRSGRHLKDPWYDRLKIPHEEIKSYILQGLNVREIPAPKADELVSFSYKGNVHCGYLIDKNNVLHVTPLNGVKLSPLAAMGAAVFYEVINENNMV
Other Proteins in cluster: phalp2_31753
| Total (incl. this protein): 146 | Avg length: 125,0 | Avg pI: 6,66 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 3ZOXH | 128 | 6,95234 |
| 10uwo | 126 | 7,93968 |
| 10yo0 | 112 | 6,82764 |
| 11GMC | 132 | 5,70359 |
| 12uBc | 133 | 8,39322 |
| 14ErR | 112 | 8,42545 |
| 16sip | 134 | 8,76939 |
| 19bAv | 122 | 8,25532 |
| 19mQd | 118 | 9,05112 |
| 1Enao | 121 | 6,41408 |
| 1I9Br | 124 | 8,12510 |
| 1MbLs | 117 | 4,88380 |
| 1Nxsz | 132 | 5,47373 |
| 1YZ50 | 117 | 6,40595 |
| 1cCFm | 126 | 6,32592 |
| 1cCOD | 126 | 8,41230 |
| 1cCOX | 126 | 6,45864 |
| 1cCzL | 125 | 6,71583 |
| 1cq7J | 126 | 7,87464 |
| 1csMt | 126 | 7,06551 |
| 1jBV5 | 124 | 5,80101 |
| 1jUTT | 126 | 7,06602 |
| 1jUZI | 126 | 6,99901 |
| 1jVaA | 128 | 8,66508 |
| 1kmLm | 122 | 5,36278 |
| 1krJt | 124 | 6,88016 |
| 1l66Y | 119 | 6,93705 |
| 1npRU | 124 | 6,03365 |
| 1qF94 | 126 | 5,47350 |
| 21A0g | 121 | 8,26203 |
| 2399F | 127 | 6,18695 |
| 25m58 | 116 | 5,91980 |
| 2Ugb6 | 115 | 5,30390 |
| 2UlkF | 115 | 5,05665 |
| 2jFDx | 116 | 5,93646 |
| 2qYEk | 115 | 6,80979 |
| 2qYLc | 117 | 7,74883 |
| 35zAp | 132 | 5,79362 |
| 35zhF | 119 | 5,31975 |
| 35zpG | 132 | 8,83160 |
| 35zzZ | 120 | 6,33064 |
| 36p5X | 136 | 5,91969 |
| 38HET | 127 | 6,50189 |
| 38IWm | 127 | 5,52324 |
| 38JKc | 138 | 5,40319 |
| 3B7NM | 124 | 8,11485 |
| 3TCAr | 136 | 5,88894 |
| 3TGCy | 123 | 8,71782 |
| 3VGA7 | 127 | 5,77543 |
| 3WK7l | 119 | 7,81997 |
| 3WOxD | 127 | 6,50007 |
| 3WzrT | 121 | 8,28549 |
| 3ZCDd | 126 | 6,55435 |
| 3ZEpf | 127 | 6,93898 |
| 3ZK6q | 117 | 6,07804 |
| 3aqS6 | 133 | 7,00304 |
| 3dVI5 | 131 | 5,55831 |
| 3e81 | 127 | 7,79637 |
| 3eTWo | 118 | 7,75184 |
| 3etsY | 121 | 5,15401 |
| 3iejP | 121 | 7,72325 |
| 3j2fi | 121 | 5,53489 |
| 40IEG | 138 | 5,54649 |
| 40Ioe | 127 | 6,95189 |
| 414Hs | 116 | 6,95268 |
| 41buE | 118 | 5,23597 |
| 41euv | 119 | 5,89053 |
| 41fub | 121 | 6,07446 |
| 41jJa | 121 | 5,77032 |
| 41kCA | 138 | 5,24024 |
| 41p5K | 132 | 7,13576 |
| 41rMM | 121 | 8,26106 |
| 41ryf | 121 | 6,40799 |
| 4B5Zo | 136 | 9,00077 |
| 4DqDE | 116 | 5,91980 |
| 4GXnu | 119 | 5,36193 |
| 4H9DZ | 116 | 4,92040 |
| 4HmFU | 130 | 6,50934 |
| 4HpDW | 117 | 5,72479 |
| 4IA27 | 139 | 6,72044 |
| 4Jx9w | 133 | 9,61625 |
| 4L1oY | 127 | 6,50132 |
| 4Lc92 | 121 | 5,50710 |
| 4Og6r | 122 | 6,95700 |
| 4OkrS | 129 | 7,73462 |
| 4knNd | 126 | 5,31833 |
| 4mZqM | 125 | 5,57371 |
| 4wJZt | 127 | 6,06031 |
| 4wMhf | 120 | 7,05039 |
| 4wOmz | 126 | 6,50309 |
| 4ytpe | 136 | 7,05954 |
| 5NWId | 142 | 4,95002 |
| 69BP | 121 | 6,09697 |
| 69wD | 120 | 6,41845 |
| 6XOfy | 97 | 5,36932 |
| 6Z36s | 126 | 8,42249 |
| 6sM5Z | 136 | 8,92650 |
| 6yf1a | 129 | 6,88885 |
| 707su | 130 | 5,30287 |
| 70WY3 | 126 | 6,45710 |
| 72X0r | 126 | 6,27505 |
| 72X5i | 126 | 6,27488 |
| 7DU9V | 136 | 6,26283 |
| 7JQU | 118 | 6,20502 |
| 7Jrpx | 133 | 8,73155 |
| 7Kgy | 132 | 7,75673 |
| 7Kll | 133 | 6,95018 |
| 7c2Z4 | 120 | 5,58201 |
| 7cOBy | 124 | 6,21684 |
| 7cODd | 124 | 6,21684 |
| 7wGrc | 132 | 7,78638 |
| 7xEyG | 124 | 5,90611 |
| 7y3k9 | 125 | 5,92958 |
| 81MeR | 121 | 8,22870 |
| 84QYB | 126 | 8,38104 |
| 87Pm7 | 126 | 5,58809 |
| 887RS | 129 | 5,81636 |
| 8NsR | 133 | 8,45298 |
| 8QF4 | 118 | 7,75161 |
| 8RgP | 118 | 6,89016 |
| 8dStT | 115 | 4,93876 |
| 8dpEo | 121 | 4,81093 |
| 8e6ul | 136 | 6,09674 |
| 8fCDg | 121 | 8,17196 |
| 8fiIZ | 122 | 8,58753 |
| 8qmFk | 115 | 5,53500 |
| 912j | 100 | 5,49692 |
| 913z | 133 | 8,80691 |
| 9V5c | 133 | 6,58181 |
| 9VaW | 132 | 8,32392 |
| Do36 | 130 | 6,41243 |
| HHLD | 125 | 6,28704 |
| K4MW | 128 | 7,76957 |
| MZJq | 142 | 5,01271 |
| Oh8z | 126 | 5,89195 |
| OqNH | 132 | 7,04584 |
| VOMv | 124 | 5,85518 |
| buHG | 130 | 5,82653 |
| eQYQ | 142 | 5,28429 |
| f7Lk | 119 | 5,09359 |
| jIbu | 117 | 8,00744 |
| lDBL | 123 | 5,74951 |
| oBD7 | 126 | 7,85465 |
| ouFw | 116 | 5,75980 |
| A0A8S5TSX1 | 137 | 5,77464 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_27353
4yLib
|
52 | 25,7% | 128 | 1.083E-21 |
| 2 |
phalp2_12585
1l6Kj
|
132 | 25,9% | 127 | 2.790E-21 |
| 3 |
phalp2_5892
5HKSo
|
183 | 26,4% | 121 | 5.243E-21 |
| 4 |
phalp2_345
6Xoqn
|
767 | 28,3% | 127 | 1.227E-19 |
| 5 |
phalp2_21754
3QymU
|
8 | 26,1% | 126 | 1.528E-18 |
| 6 |
phalp2_33663
W975
|
5 | 28,5% | 126 | 5.390E-18 |
| 7 |
phalp2_38701
Qvcb
|
12 | 35,0% | 117 | 1.724E-16 |
| 8 |
phalp2_25767
4SEil
|
42 | 28,0% | 121 | 1.561E-15 |
| 9 |
phalp2_38609
25FGT
|
2035 | 22,2% | 126 | 2.930E-15 |
| 10 |
phalp2_25010
PR2K
|
31 | 25,6% | 113 | 1.032E-14 |
Domains
Domains
No domain annotations available.
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(3ZOXH)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50