Protein
- Protein accession
- 1bXZM [EnVhog]
- Representative
- 8Jtqs
- Source
- EnVhog (cluster: phalp2_6450)
- Protein name
- 1bXZM
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MSFIKYEYIRINKFSRPGIKNYGVKGIIMHYTANNGGTARNHKDYFNNLNGVYASAHLFVDDNEAICIIPLDEVAYHANDTVRYNSDGSIYKPLYSQIGNANYGAIGVEMCLDRNGNITEKTFQNTVKAVKELIAKYPNITRNKIWRHYDVTGKNCPAPWVAKPSELERFKDAVFGRTSGSNSAAKPSTPSVKPNTNKIQEDGMFGPSTANKAMQYEGITPDDEISHQYRQACNKNLYAAQFDNTLKGSTLIRTWQKRLKAKGLYNGAVDGLCGKNTIKAMQKALESF
- Physico‐chemical
properties -
protein length: 288 AA molecular weight: 32222,1 Da isoelectric point: 9,33 hydropathy: -0,60
Representative Protein Details
- Accession
- 8Jtqs
- Protein name
- 8Jtqs
- Sequence length
- 288 AA
- Molecular weight
- 31868,80840 Da
- Isoelectric point
- 9,79708
- Sequence
-
MVQIKKQLVSSRKNTYTGINGRKYITIHETDNTNKGANAQAHANLQSRGNSRSASWHWTVDDKEAIQSFPHTVRCWAAGDGEGNGNFNSIHIEICVNSDGDFNKAVENAAALTRMIMEQENIPLSNVVQHNHWSGKNCPRNLRSGSKGMTWNDFLNMVVGKKVDTPKKEVKPAQTKNKTNIIVDGKWGSETTKALQKALGTVVDGVISSQPRNHVTAAIYDGITWGTKGSMMVRALQKKVGAKVNGKLDSETIRKLQKYLGTPIDGKISRPESLMVKELQRRLNEGTF
Other Proteins in cluster: phalp2_6450
| Total (incl. this protein): 137 | Avg length: 296,4 | Avg pI: 8,76 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8Jtqs | 288 | 9,79708 |
| 13D1N | 301 | 5,36034 |
| 1HKgp | 222 | 9,51684 |
| 1abKI | 314 | 9,48022 |
| 1bEUQ | 317 | 9,25897 |
| 1bSoI | 317 | 9,18463 |
| 1bUEL | 310 | 9,51665 |
| 1bt46 | 314 | 9,54159 |
| 1bxc2 | 316 | 9,53856 |
| 1c1Fc | 260 | 9,39970 |
| 1c82q | 311 | 9,50601 |
| 1c9dg | 314 | 9,46894 |
| 1ccl6 | 262 | 9,01605 |
| 1cgJD | 322 | 9,47326 |
| 1cjbK | 314 | 9,42929 |
| 1jKUi | 314 | 9,49421 |
| 1jKXj | 314 | 9,27121 |
| 1m0Sz | 272 | 9,27495 |
| 1m1bj | 313 | 9,57028 |
| 1mJuP | 262 | 9,01605 |
| 1mYYX | 305 | 4,77518 |
| 1msRF | 314 | 9,49434 |
| 1mssI | 321 | 9,51645 |
| 1o4li | 295 | 4,75523 |
| 1oj1t | 253 | 4,76523 |
| 2G569 | 288 | 9,78960 |
| 2G7og | 304 | 9,61296 |
| 2G8Rm | 304 | 9,66454 |
| 2Yv0L | 293 | 9,68929 |
| 2Yv9U | 295 | 9,83763 |
| 2dhDg | 306 | 9,09676 |
| 2jYtB | 259 | 9,11855 |
| 3BTCw | 322 | 9,35599 |
| 3BTEB | 312 | 9,70354 |
| 3BTEe | 314 | 9,37636 |
| 3O4Y | 317 | 6,27550 |
| 3Va2P | 318 | 5,80630 |
| 3e4v5 | 298 | 7,05221 |
| 3jHPe | 321 | 5,13901 |
| 3jTeL | 310 | 9,62302 |
| 3swgp | 438 | 5,00651 |
| 44XZ9 | 318 | 5,83085 |
| 4LA4i | 268 | 9,00490 |
| 4LDUj | 279 | 9,33691 |
| 4LhnR | 270 | 9,16871 |
| 4Lo6e | 245 | 9,15665 |
| 4Lvw6 | 255 | 9,34864 |
| 4LwGH | 270 | 9,11591 |
| 4Lza4 | 272 | 9,47493 |
| 4MKGt | 256 | 9,43664 |
| 4MPUJ | 274 | 9,40054 |
| 4lyka | 312 | 6,10044 |
| 5NQOk | 261 | 9,42097 |
| 5O2IY | 279 | 6,83048 |
| 5ObGY | 313 | 9,50485 |
| 5Snjr | 316 | 9,55907 |
| 5hPUR | 283 | 8,74567 |
| 5hS73 | 300 | 9,61689 |
| 5hSas | 300 | 9,68691 |
| 5imGi | 259 | 6,66457 |
| 5tDlr | 291 | 9,38706 |
| 69MGK | 285 | 9,45263 |
| 69Vgq | 262 | 9,01605 |
| 6UKKT | 288 | 9,39938 |
| 6bsyw | 280 | 6,15461 |
| 6dEYk | 196 | 4,68015 |
| 72xff | 249 | 9,22699 |
| 752ah | 259 | 9,01618 |
| 752bH | 259 | 9,02662 |
| 758Vj | 245 | 9,12713 |
| 75CZc | 232 | 9,51871 |
| 75OSk | 359 | 9,44534 |
| 76gOX | 284 | 9,56461 |
| 76hD7 | 280 | 9,59620 |
| 77iWW | 325 | 9,83983 |
| 79xRV | 316 | 9,70283 |
| 7Xvjf | 314 | 9,46894 |
| 7ZGGm | 283 | 4,72198 |
| 7aZRU | 222 | 9,63817 |
| 7cKxe | 222 | 9,65010 |
| 7coba | 291 | 6,93699 |
| 7cype | 293 | 9,44289 |
| 7drhg | 226 | 9,65055 |
| 7fJ3n | 273 | 5,86001 |
| 7fLPR | 309 | 5,57672 |
| 7lBrW | 250 | 9,07233 |
| 7lDUy | 259 | 9,01605 |
| 7lE4p | 314 | 9,41872 |
| 7mxKf | 289 | 7,65135 |
| 7ouii | 314 | 9,44747 |
| 7pYRe | 258 | 8,85630 |
| 7qIpX | 223 | 9,58260 |
| 7rMwZ | 222 | 9,56590 |
| 7rVNF | 296 | 6,14216 |
| 7s43h | 226 | 9,66795 |
| 7sbAF | 263 | 6,11721 |
| 7sxY9 | 226 | 9,60490 |
| 7sy0c | 226 | 9,61038 |
| 7wkwS | 381 | 9,32820 |
| 7x4ai | 259 | 9,20791 |
| 7x4b4 | 259 | 9,11855 |
| 7xE51 | 293 | 9,50672 |
| 7zjgr | 292 | 9,23917 |
| 8138 | 234 | 9,50092 |
| 86j9q | 314 | 9,40847 |
| 87Ws4 | 314 | 9,53889 |
| 89VWK | 310 | 9,86858 |
| 8czdA | 327 | 4,79581 |
| 8obEn | 314 | 9,43683 |
| 8owng | 285 | 6,04263 |
| 8tTNL | 269 | 9,37056 |
| 9wCP | 278 | 6,79143 |
| OGJx | 276 | 4,82162 |
| aJoB | 289 | 9,32285 |
| aQSb | 289 | 9,68671 |
| cFyJ | 253 | 9,36418 |
| A0A1L2JY70 | 288 | 9,79708 |
| R4JGH8 | 364 | 9,75447 |
| A0A217ER07 | 360 | 9,55855 |
| A0A2P1JU23 | 330 | 9,64146 |
| A0A7T8C4M4 | 364 | 9,76491 |
| A0A9X9E1J8 | 360 | 9,50014 |
| A0AAE7S5U2 | 364 | 9,75447 |
| A0AAE7SCR8 | 364 | 9,75447 |
| A0AAE9YE35 | 360 | 9,53876 |
| A0AAE9YEG1 | 361 | 9,46894 |
| A0AAE9YG27 | 360 | 9,53876 |
| A0AAE9YKD0 | 360 | 9,50949 |
| A0AAE9YM67 | 360 | 9,53876 |
| A0AAN0N6V3 | 364 | 9,75447 |
| A0AAX4NUD1 | 360 | 9,60194 |
| A0AAX4Q5N7 | 364 | 9,75447 |
| A0AAX4Q5P0 | 364 | 9,75447 |
| A0AAX4Q7D7 | 364 | 9,75447 |
| A0AAX4Q8J7 | 364 | 9,75447 |
| D6QWL8 | 329 | 9,68716 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_24835
7sl6i
|
39 | 44,5% | 321 | 1.693E-79 |
| 2 |
phalp2_7826
aMK
|
29 | 64,6% | 181 | 3.844E-69 |
| 3 |
phalp2_29544
3KzTO
|
225 | 43,7% | 231 | 3.734E-63 |
| 4 |
phalp2_4901
5Zr0m
|
117 | 31,2% | 358 | 4.090E-61 |
| 5 |
phalp2_17898
EGF4
|
130 | 33,7% | 305 | 1.351E-54 |
| 6 |
phalp2_15067
7vQ2g
|
6 | 38,7% | 209 | 2.054E-47 |
| 7 |
phalp2_416
7vQHy
|
10 | 34,4% | 308 | 6.317E-46 |
| 8 |
phalp2_33474
7qPh3
|
3 | 41,2% | 177 | 2.995E-45 |
| 9 |
phalp2_14020
81gAb
|
48 | 27,1% | 195 | 2.995E-45 |
| 10 |
phalp2_27725
6UNCq
|
90 | 34,7% | 242 | 4.089E-45 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8Jtqs)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50