Protein
- Protein accession
- 1Zag0 [EnVhog]
- Representative
- 4pcMq
- Source
- EnVhog (cluster: phalp2_5650)
- Protein name
- 1Zag0
- Lysin probability
- 98%
- PhaLP type
-
VAL
Probability: 91% (predicted by ML model) - Protein sequence
-
MSTPFFNTPDRIAKLQFYAGTWIGTPFMPNAAFKGSGVSCQKLVGSILVECGALPKDFAIPEGPMDWAGAHKDSIIAQFLDEHPEHFTVVENKFAPQPGDLIGLKIGGCVHHLGLMLAAEGTFIHCLRNNGTTTNNIHDASYWIRIGQVWRPVTQ
- Physico‐chemical
properties -
protein length: 155 AA molecular weight: 16962,3 Da isoelectric point: 6,35 hydropathy: -0,01
Representative Protein Details
- Accession
- 4pcMq
- Protein name
- 4pcMq
- Sequence length
- 145 AA
- Molecular weight
- 15603,81060 Da
- Isoelectric point
- 6,99946
- Sequence
-
MTAALDALIVKEAMSWVGTPFVHGASVKGSGCDCLGLIKGVYENVFSCTADALPVYPATFWQDAGWHTLFLNRLHKVAGPSWTGPEAGRLLLFAKNGVLTHLGLGVDAQSMIHTSSDPRVGRVCHAPVRLVNGLSLWGVWSFRED
Other Proteins in cluster: phalp2_5650
| Total (incl. this protein): 141 | Avg length: 153,5 | Avg pI: 7,08 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4pcMq | 145 | 6,99946 |
| 16KaK | 144 | 8,64142 |
| 16bAp | 145 | 7,98526 |
| 16k5r | 151 | 6,85992 |
| 1DiEO | 156 | 7,04345 |
| 1ImoD | 186 | 9,63275 |
| 1LGuV | 155 | 8,60900 |
| 1YY9i | 159 | 8,46884 |
| 1dD7v | 149 | 6,30540 |
| 1kP3B | 180 | 7,00219 |
| 1p5Hf | 144 | 6,29289 |
| 1pN8O | 182 | 6,71009 |
| 279fH | 150 | 5,42036 |
| 2FAB6 | 163 | 6,28420 |
| 2IGYj | 168 | 8,54833 |
| 2OQuc | 163 | 6,28300 |
| 2S5Dh | 151 | 5,95681 |
| 2UnhN | 164 | 6,94467 |
| 2buiY | 151 | 6,12994 |
| 2rMZL | 145 | 8,59546 |
| 31ujg | 131 | 6,01330 |
| 37IGH | 149 | 7,77987 |
| 3Mo0T | 146 | 6,94387 |
| 3OMll | 145 | 6,90232 |
| 3Pto5 | 148 | 9,34245 |
| 3T9zi | 145 | 7,83950 |
| 3Xksi | 145 | 6,53952 |
| 3cT59 | 156 | 6,90545 |
| 3eYNq | 148 | 8,31502 |
| 3eYV0 | 148 | 7,01100 |
| 3zYJY | 156 | 9,09567 |
| 40VQW | 139 | 6,50189 |
| 44fUm | 150 | 5,40933 |
| 45YRC | 150 | 5,60639 |
| 46Pt9 | 146 | 6,62597 |
| 49RWt | 149 | 6,39691 |
| 49hYY | 150 | 5,60639 |
| 4AIBj | 158 | 6,17666 |
| 4E2us | 154 | 6,28863 |
| 4ED8U | 145 | 6,69907 |
| 4EMwY | 165 | 6,39702 |
| 4EcTo | 190 | 5,92827 |
| 4ExLA | 168 | 6,31609 |
| 4Fy0p | 148 | 8,49598 |
| 4HWEK | 159 | 9,58717 |
| 4IHBS | 132 | 6,26521 |
| 4Ib2s | 159 | 9,04564 |
| 4IdW4 | 154 | 7,68687 |
| 4KWBM | 145 | 7,76775 |
| 4KWqt | 149 | 7,06460 |
| 4LCd4 | 142 | 6,70276 |
| 4NZ2x | 138 | 6,12795 |
| 4O2WB | 150 | 5,82125 |
| 4T2Y6 | 118 | 6,57612 |
| 4WkYT | 187 | 7,66931 |
| 4Y64l | 162 | 8,68836 |
| 4Y7Cf | 148 | 8,23250 |
| 4Y7V5 | 192 | 5,88388 |
| 4aS5t | 150 | 7,86967 |
| 4asCE | 145 | 6,99946 |
| 4bTs5 | 150 | 5,40933 |
| 4bbD0 | 145 | 6,99946 |
| 4cCld | 159 | 9,00702 |
| 4dmNq | 151 | 8,67939 |
| 4du2k | 144 | 6,29181 |
| 4eXFX | 155 | 6,70560 |
| 4fnFT | 151 | 7,88360 |
| 4i0zO | 151 | 9,44322 |
| 4iBnf | 151 | 9,60213 |
| 4wdui | 165 | 6,85742 |
| 4yz5h | 156 | 6,04763 |
| 514To | 148 | 6,74732 |
| 521Ow | 150 | 5,59821 |
| 530J0 | 150 | 5,60401 |
| 538JP | 150 | 5,42036 |
| 57EBr | 150 | 5,81431 |
| 5DScZ | 153 | 6,22378 |
| 5JJK | 154 | 8,24030 |
| 5Jwj4 | 154 | 6,22060 |
| 5aTtp | 150 | 5,44111 |
| 5eRFA | 150 | 5,39791 |
| 5et1D | 150 | 5,91662 |
| 5fYLY | 150 | 5,60639 |
| 5kQqs | 150 | 5,82483 |
| 5nDvZ | 152 | 8,53969 |
| 5sO24 | 148 | 8,48128 |
| 5xMqi | 145 | 6,95615 |
| 5zECZ | 178 | 9,70960 |
| 5zFkM | 135 | 6,39799 |
| 5zPZA | 151 | 7,85459 |
| 6D7KW | 153 | 6,86913 |
| 6FyTM | 186 | 8,91393 |
| 6GwGb | 150 | 5,42036 |
| 6HUXl | 143 | 6,64564 |
| 6HY4R | 159 | 5,67119 |
| 6HYjJ | 149 | 9,00064 |
| 6I2Dl | 132 | 6,57038 |
| 6I3ty | 158 | 8,41991 |
| 6I7nB | 139 | 7,82248 |
| 6KDAv | 176 | 9,99913 |
| 6Lgig | 211 | 9,27276 |
| 6M28G | 145 | 5,82079 |
| 6NavW | 149 | 5,33249 |
| 6Nc1L | 179 | 9,83628 |
| 6Nd1B | 150 | 5,85717 |
| 6Ps2l | 159 | 6,42374 |
| 6Puxb | 159 | 7,76417 |
| 6Pvp2 | 159 | 8,83657 |
| 6Q7qz | 159 | 7,00452 |
| 6QGks | 154 | 6,49018 |
| 6R22D | 159 | 8,49759 |
| 6Szb3 | 146 | 7,09398 |
| 6UBXe | 145 | 6,57232 |
| 6UQJH | 142 | 6,89545 |
| 6WiUT | 154 | 6,12715 |
| 6Wkxs | 152 | 8,70596 |
| 6XXvq | 145 | 8,88479 |
| 6XzRJ | 158 | 6,28630 |
| 7a2v | 150 | 5,80442 |
| 89J98 | 167 | 6,28096 |
| 8aQ3E | 171 | 5,30083 |
| 8aibM | 149 | 6,89272 |
| 8btB3 | 149 | 6,49803 |
| 8oJBd | 145 | 6,48626 |
| 8rg3c | 168 | 6,27851 |
| Cb2i | 150 | 5,81431 |
| DyXU | 150 | 5,60639 |
| ThYT | 152 | 7,09796 |
| Ye46 | 158 | 7,63543 |
| Ypkr | 145 | 7,86103 |
| boNQ | 137 | 6,36701 |
| f63E | 164 | 5,93697 |
| fNH0 | 149 | 9,36695 |
| gBPt | 138 | 6,50598 |
| gNOv | 137 | 6,58266 |
| kbks | 167 | 5,78294 |
| kkny | 151 | 8,86377 |
| lFK7 | 156 | 6,36667 |
| lolG | 153 | 9,07407 |
| mGEp | 150 | 6,37031 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_38924
255eJ
|
167 | 29,8% | 124 | 7.222E-27 |
| 2 |
phalp2_6310
6XJ6z
|
42 | 28,1% | 149 | 1.684E-25 |
| 3 |
phalp2_770
1ZuRJ
|
24 | 26,3% | 114 | 1.009E-23 |
| 4 |
phalp2_28842
4Yzgy
|
55 | 24,3% | 119 | 1.382E-23 |
| 5 |
phalp2_3108
42cAw
|
297 | 28,0% | 121 | 2.346E-22 |
| 6 |
phalp2_922
7oz39
|
3811 | 37,8% | 119 | 3.978E-21 |
| 7 |
phalp2_28828
4VfNo
|
465 | 32,6% | 92 | 2.366E-19 |
| 8 |
phalp2_40506
4Elik
|
50 | 29,3% | 126 | 2.366E-19 |
| 9 |
phalp2_5548
3QhkB
|
69 | 26,2% | 137 | 6.072E-19 |
| 10 |
phalp2_23009
3Pkvx
|
60 | 27,0% | 111 | 1.402E-17 |
Domains
Domains
No domain annotations available.
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4pcMq)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50