Protein
- Protein accession
- K4FBZ6 [UniProt]
- Representative
- 8KTfD
- Source
- UniProt (cluster: phalp2_21078)
- Protein name
- Transglycosylase SLT domain-containing protein
- Lysin probability
- 100%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MRKALLAGLLAISMMAHSSEHTFSNVQLDNMRYAYQFGEQFSKDGKYKTHKNIHKSGLGHIMAAILWQESSGGVNLKSKPKHHAYGMFQNYLPTMRARVKELGYNMTDAEIKRMLNKRSNSASWAYIELSYWLNIHKGDIRKAISSYNSGWNVKAGSKYASEVLEKANYLKNNKLLE
- Physico‐chemical
properties -
protein length: 177 AA molecular weight: 20239,0 Da isoelectric point: 9,82 hydropathy: -0,58
Representative Protein Details
- Accession
- 8KTfD
- Protein name
- 8KTfD
- Sequence length
- 77 AA
- Molecular weight
- 9038,33190 Da
- Isoelectric point
- 9,58363
- Sequence
-
MDKSYSKRVVINKLESLRGGSKFAIHELEYWLDYHKGDLKKALASYNAGFKYTKKEARDYARMVNHTAKLLEEKQII
Other Proteins in cluster: phalp2_21078
| Total (incl. this protein): 154 | Avg length: 179,2 | Avg pI: 9,61 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8KTfD | 77 | 9,58363 |
| 7BUL0 | 77 | 9,58363 |
| D9ICK0 | 77 | 9,58363 |
| A0A5Q2W6R0 | 182 | 9,66331 |
| A0A5C0CDQ9 | 204 | 9,65261 |
| A0A6B9XZM0 | 183 | 9,63024 |
| A0A2Z4QCS4 | 180 | 9,67653 |
| A0A3T0IME2 | 186 | 8,71717 |
| A0A2S1GQC1 | 181 | 9,76034 |
| A0A0M7QBV3 | 181 | 9,76034 |
| A0A6B9WR96 | 180 | 9,69729 |
| A0A192Y9R9 | 184 | 8,59894 |
| A0A240F378 | 139 | 9,90603 |
| A0A0G2SS69 | 186 | 8,41295 |
| E3SFK4 | 167 | 9,54237 |
| A0A6B9X0M0 | 179 | 9,52200 |
| A0A1J0GSF1 | 181 | 9,76034 |
| A0A0A0YVH4 | 182 | 9,46817 |
| A0A172Q184 | 179 | 9,52200 |
| A0A6G8RMY8 | 204 | 9,60523 |
| A0A5P8PHD2 | 181 | 9,56390 |
| A0A0A7HC85 | 179 | 9,59143 |
| A0A1V0DXM3 | 183 | 9,41549 |
| A0A1Z1LXH5 | 182 | 9,57944 |
| C4MZJ9 | 179 | 9,57306 |
| A0A0K1LKF3 | 179 | 9,54043 |
| E5E4C1 | 173 | 10,03046 |
| S5M388 | 181 | 9,76034 |
| A0A023W6J3 | 181 | 9,54218 |
| A0A088FS33 | 180 | 9,69729 |
| A0A7L4YF50 | 204 | 9,65261 |
| A0A7L4YHL4 | 204 | 9,65261 |
| A0A6G6XTK4 | 204 | 9,71643 |
| A0A7T3TKQ4 | 204 | 9,60523 |
| A0A2H4YFQ7 | 182 | 9,48415 |
| A0A5B9N0D1 | 180 | 9,69729 |
| A0A0A7HDR1 | 180 | 9,52161 |
| I7J3X6 | 183 | 9,41549 |
| A0A0A7HEH1 | 180 | 9,52161 |
| A0A0B6VTU9 | 183 | 9,65132 |
| A0A0K1LML3 | 182 | 9,41053 |
| A0A2U7NLU2 | 176 | 9,45024 |
| A0A0A7HFX4 | 180 | 9,52161 |
| A0A0M7QD78 | 181 | 9,78322 |
| A0A172Q1Z9 | 179 | 9,52200 |
| A0A2S1GP75 | 120 | 9,75473 |
| A0A2S1GRS7 | 179 | 9,54043 |
| A0A2Z5HKU3 | 205 | 9,71869 |
| A0A2Z5WKM3 | 181 | 9,71908 |
| A0A2Z6C8E4 | 204 | 9,65261 |
| A0A385IPB4 | 205 | 9,71869 |
| A0A386KLQ0 | 181 | 9,76034 |
| A0A3G2K911 | 204 | 9,65261 |
| A0A3G3MC21 | 180 | 9,69729 |
| A0A3T0ILR9 | 179 | 9,54043 |
| A0A410T4G0 | 179 | 9,54043 |
| A0A411BCJ6 | 205 | 9,71869 |
| A0A449C5U2 | 181 | 9,76034 |
| A0A482GH36 | 181 | 9,76034 |
| A0A482JPK4 | 185 | 9,52071 |
| A0A4D6BJX6 | 183 | 9,76536 |
| A0A4D6DX78 | 180 | 9,69729 |
| A0A513QBR4 | 204 | 9,71643 |
| A0A514U5M0 | 181 | 9,76034 |
| A0A5B9MV82 | 181 | 9,76034 |
| A0A5B9NGJ6 | 181 | 9,74744 |
| A0A5B9NNW5 | 182 | 9,64229 |
| A0A5C0CBB0 | 205 | 9,71869 |
| A0A6B9WKN3 | 196 | 9,92254 |
| A0A6B9WL40 | 181 | 9,73822 |
| A0A6B9XAL7 | 180 | 9,69729 |
| A0A6G8RLH4 | 205 | 9,71869 |
| A0A6G8RNC6 | 205 | 9,71869 |
| A0A6H0XAZ7 | 181 | 9,76034 |
| A0A6H1Z5X2 | 185 | 9,38803 |
| A0A6J3ZUW5 | 181 | 9,71908 |
| A0A7D5FJ75 | 181 | 9,76034 |
| A0A7D5FQ35 | 185 | 9,56919 |
| A0A7G3KB11 | 183 | 9,63024 |
| A0A7G3M6Z8 | 205 | 9,71869 |
| A0A7G5BCK5 | 180 | 9,52161 |
| A0A7I8N393 | 205 | 9,71869 |
| A0A7L8G427 | 205 | 9,71869 |
| A0A7T3N814 | 205 | 9,71869 |
| A0A7T3N930 | 205 | 9,71869 |
| A0A7T7CKT1 | 184 | 8,59894 |
| A0A7T7K7S7 | 181 | 9,74744 |
| A0A7T7K8J6 | 181 | 9,71908 |
| A0A7T8EI96 | 205 | 9,71869 |
| A0A7T8ELW5 | 205 | 9,71869 |
| A0A7T8EMA8 | 205 | 9,71869 |
| A0A7U0G943 | 184 | 8,59894 |
| A0A7U0GAG6 | 186 | 8,41140 |
| A0A7U3SR13 | 179 | 9,54043 |
| A0A7U3TBK5 | 180 | 9,60058 |
| A0A7U3WDN2 | 182 | 9,23170 |
| A8R9A7 | 179 | 9,59143 |
| D7RMB4 | 179 | 9,54043 |
| G1FH40 | 181 | 9,76034 |
| K4I4R4 | 204 | 9,67317 |
| Q56EQ6 | 183 | 9,69529 |
| S4TQ30 | 168 | 10,04754 |
| U5PYZ1 | 205 | 9,71869 |
| W8JF06 | 205 | 9,71869 |
| A0A140XB97 | 168 | 9,24575 |
| A0A193H0S3 | 120 | 9,69690 |
| A0A219Y9C6 | 139 | 9,90603 |
| A0A219YAI1 | 139 | 9,90603 |
| A0A219YD94 | 139 | 9,90603 |
| A0A240F3V1 | 139 | 9,90603 |
| A0A2P1JU92 | 130 | 10,14315 |
| A0A858HZG9 | 180 | 9,60058 |
| A0A868BQZ4 | 186 | 9,76859 |
| A0A873WLF5 | 181 | 9,48344 |
| A0A899ILY7 | 180 | 9,76034 |
| A0A8F1NHX4 | 180 | 9,60058 |
| A0A8F3HMA2 | 180 | 9,69729 |
| A0A8X8M4E1 | 162 | 9,57828 |
| A0A8X8MBL9 | 180 | 9,69729 |
| A0A8X8RHS6 | 162 | 9,57828 |
| A0A976S427 | 183 | 9,63024 |
| A0A976XMH5 | 182 | 9,64236 |
| A0A9E7MJ54 | 204 | 9,29977 |
| A0A9E7T0D4 | 162 | 9,57828 |
| A0AA49EIH5 | 181 | 9,56390 |
| A0AA49GZQ0 | 182 | 9,64236 |
| A0AA50FE94 | 180 | 9,69729 |
| A0AA51U8N0 | 180 | 9,57950 |
| A0AA94YNC8 | 183 | 9,70702 |
| A0AA94YPN6 | 183 | 9,70702 |
| A0AA94YRI3 | 183 | 9,70702 |
| A0AA94YS33 | 183 | 9,70702 |
| A0AA94YT89 | 183 | 9,70702 |
| A0AA95C6W9 | 183 | 9,70702 |
| A0AA96Q3Y1 | 181 | 9,76034 |
| A0AAD1QU57 | 179 | 9,61070 |
| A0AAD1QW41 | 179 | 9,61070 |
| A0AAE7MTY6 | 204 | 9,65261 |
| A0AAE7RLA2 | 180 | 9,69729 |
| A0AAE7RZK2 | 180 | 9,76066 |
| A0AAE7WG81 | 183 | 9,63024 |
| A0AAE8Z454 | 180 | 9,57950 |
| A0AAE8Z819 | 202 | 9,29977 |
| A0AAE9HJG2 | 77 | 9,66209 |
| A0AAE9HMW1 | 180 | 9,63720 |
| A0AAE9HN53 | 77 | 8,83083 |
| A0AAE9W5S7 | 204 | 9,65261 |
| A0AAF0FJK6 | 181 | 9,73822 |
| A0AAF1K0V3 | 181 | 9,64500 |
| A0AAX4R0F1 | 180 | 9,62341 |
| A0AAX4R0T1 | 180 | 9,67620 |
| A0AB38Z356 | 179 | 9,54043 |
| A0AB39U1S2 | 181 | 9,74744 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_31960
7PBFx
|
121 | 61,8% | 76 | 4.975E-36 |
| 2 |
phalp2_8837
2ABSl
|
1 | 28,5% | 70 | 1.383E-04 |
Domains
Domains [InterPro]
1
77 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Escherichia phage vB_EcoM_ACG-C40 [NCBI] |
1141141 | Straboviridae > Tequatrovirus > Tequatrovirus c40 |
| Host |
Escherichia coli [NCBI] |
562 | Proteobacteria > Gammaproteobacteria > Enterobacteriales > Enterobacteriaceae > Escherichia > |
Coding sequence (CDS)
Coding sequence (CDS)
CDS Source ID
CDS Source
JN986846
[NCBI]
CDS location
range 59578 -> 60111
strand -
strand -
CDS
ATGAGAAAAGCACTACTCGCTGGTCTATTGGCCATTTCAATGATGGCACATAGCTCCGAGCATACTTTCAGTAATGTCCAACTCGATAACATGCGTTACGCGTATCAATTCGGGGAACAATTTTCTAAGGATGGAAAATATAAAACACACAAAAATATCCACAAGAGCGGATTAGGTCATATAATGGCTGCTATTTTATGGCAAGAAAGCTCTGGCGGAGTTAATTTAAAATCTAAACCAAAGCATCACGCTTATGGAATGTTCCAAAATTATTTGCCTACTATGCGAGCAAGAGTTAAGGAACTTGGTTATAATATGACCGATGCTGAAATAAAAAGAATGTTGAATAAACGATCCAATTCAGCTTCCTGGGCGTACATTGAACTTTCTTATTGGTTAAATATACATAAGGGCGATATAAGAAAAGCAATATCCTCTTATAATTCGGGATGGAATGTTAAAGCAGGTTCTAAATATGCTTCTGAAGTCCTAGAAAAGGCTAATTACCTTAAAAATAATAAACTTTTGGAATAG
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
PDB ID
upi000297077e_model
Method
AlphaFold3 (non-commercial)
Resolution
-
Chain position
-
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50
The structures below correspond to the cluster representative
(8KTfD)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50