Protein
- Protein accession
- D6QWL5 [UniProt]
- Representative
- 7wtdu
- Source
- UniProt (cluster: phalp2_3982)
- Protein name
- N-acetylmuramoyl-L-alanine amidase
- Lysin probability
- 100%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MSINVVKNLVSSSKYSVKCPYPMNPEIIVVHNTANDASAKSEISYMINNNNEVSYHFAVDDKEVVQGLPLNRNGWHAGDGGSGRGNRKGIGVEICYSKSGGIKYKKAEVLAIKFIAQLLHERNWSIDRVKTHNQMNGKYCPHRILSEGRWDDVLRAIQKELDRLNNVEVKPAPDTQVDSEITTKPNKPKEENKVESI
- Physico‐chemical
properties -
protein length: 197 AA molecular weight: 22116,8 Da isoelectric point: 8,86 hydropathy: -0,66
Representative Protein Details
- Accession
- 7wtdu
- Protein name
- 7wtdu
- Sequence length
- 323 AA
- Molecular weight
- 35008,59110 Da
- Isoelectric point
- 9,98797
- Sequence
-
MTITVKKNLVSKAKYSLKCSNPMTAEYITIHNTANDASAANEISYMINNTNSTSFHFAVDDKEVRQGIPTNRNAWHTGDGKNGTGNRKSIGVEICYSKSGGARYKKAEALAIKFVAQLLKERGWGIDHVRKHQDWNGKYCPHRILSEGRWEQVKAAIAAELERLGGKKASSPAKTKASGATYTVKKGDALSVIAQKTGVSMATLQSLNGIKNPNFIKVGQVLKLTGSSTSSPKPSSKKTSYALPSGVIRVTRPMRKGDDVRQVQNALAALYFYPDKGAKNNGIDGVYGPKTANAVKRFQSVNGLTADGIYGPKTKAKIEEKLK
Other Proteins in cluster: phalp2_3982
| Total (incl. this protein): 333 | Avg length: 317,0 | Avg pI: 9,38 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7wtdu | 323 | 9,98797 |
| 13rNn | 371 | 7,97089 |
| 13wB0 | 215 | 9,43000 |
| 1Bu19 | 330 | 9,82397 |
| 1E1zN | 359 | 9,79592 |
| 1E7PF | 359 | 9,86568 |
| 1GA1L | 359 | 9,75028 |
| 1GGw6 | 326 | 9,79483 |
| 1GVPi | 359 | 9,83422 |
| 1GVTg | 357 | 9,85027 |
| 1Gy9R | 359 | 9,80643 |
| 1GzZo | 313 | 9,80837 |
| 1HKqn | 287 | 9,45495 |
| 1fZew | 287 | 9,29126 |
| 1gFcM | 270 | 9,29997 |
| 1lZDK | 357 | 8,95725 |
| 1m5pe | 377 | 9,20746 |
| 1nWHn | 370 | 8,90729 |
| 1o4Su | 378 | 8,76688 |
| 24kL7 | 275 | 9,31138 |
| 2VFUn | 279 | 9,87328 |
| 2nZyb | 247 | 9,53940 |
| 3McKX | 273 | 9,62057 |
| 3PZQx | 266 | 5,64453 |
| 3hsFK | 326 | 9,90726 |
| 3hxuu | 326 | 9,80708 |
| 3iJyk | 311 | 9,81339 |
| 3jIhc | 351 | 8,67275 |
| 3jMUr | 375 | 8,23231 |
| 3jMsT | 371 | 7,57376 |
| 3jXQi | 375 | 8,23592 |
| 3jXkj | 350 | 8,66702 |
| 3kAGY | 371 | 7,13968 |
| 3kAHd | 351 | 8,67275 |
| 3kBBL | 371 | 7,96463 |
| 3kBqk | 383 | 8,98942 |
| 3kGRs | 383 | 9,09657 |
| 3kgEu | 381 | 9,28127 |
| 3lHgD | 371 | 7,57342 |
| 3oPAn | 350 | 8,34087 |
| 3pJFu | 385 | 9,45082 |
| 3q7QN | 386 | 9,07285 |
| 3qZ4L | 308 | 7,68511 |
| 3rTjj | 383 | 9,05789 |
| 3srFA | 371 | 6,82644 |
| 3uuEt | 375 | 8,41082 |
| 3wTKZ | 350 | 8,52351 |
| 4hcCP | 279 | 9,92673 |
| 4hcEi | 325 | 9,61309 |
| 4hcde | 314 | 9,68562 |
| 4hcuk | 359 | 9,86568 |
| 4hcyw | 279 | 9,92673 |
| 4kZlf | 254 | 7,62310 |
| 5PHnK | 350 | 8,66702 |
| 5Swd2 | 383 | 9,12629 |
| 5VGNg | 383 | 9,06550 |
| 5Waab | 371 | 8,22754 |
| 5WuTb | 350 | 8,06256 |
| 5XGID | 385 | 9,48557 |
| 5YCkB | 371 | 7,98991 |
| 5YKpP | 350 | 8,51887 |
| 5YRSJ | 297 | 9,45411 |
| 5Zq2k | 303 | 9,39699 |
| 63iLn | 282 | 9,23795 |
| 67xsH | 375 | 8,22754 |
| 67zJF | 350 | 8,66141 |
| 68bBb | 350 | 8,67894 |
| 69T5V | 383 | 9,19662 |
| 6OD3q | 332 | 10,22941 |
| 6Tf1O | 329 | 9,70296 |
| 6TxV9 | 273 | 9,83538 |
| 6bYAF | 375 | 7,99938 |
| 6dMze | 274 | 8,93598 |
| 6egAA | 385 | 9,36295 |
| 6iD1s | 291 | 9,09689 |
| 6ldnA | 371 | 8,22399 |
| 6pzom | 367 | 7,97998 |
| 6soce | 385 | 9,40344 |
| 6sqtX | 350 | 8,52873 |
| 6tZyY | 371 | 8,22405 |
| 6vwf1 | 335 | 9,01772 |
| 6wEwt | 282 | 9,24942 |
| 71ULn | 323 | 9,79934 |
| 71UgF | 324 | 9,66492 |
| 723Vj | 371 | 7,57535 |
| 72Ahm | 279 | 9,78335 |
| 73GKg | 317 | 9,48248 |
| 74A7r | 324 | 9,79928 |
| 74elp | 325 | 9,79934 |
| 74g4j | 317 | 9,42091 |
| 74iMs | 323 | 9,70296 |
| 74iMw | 317 | 9,43187 |
| 7506R | 259 | 9,81307 |
| 7509n | 325 | 9,80772 |
| 752Ou | 330 | 9,81384 |
| 759qT | 324 | 9,83435 |
| 759qe | 325 | 9,70322 |
| 75AQ5 | 314 | 9,62901 |
| 75ARW | 272 | 9,72307 |
| 75ARx | 324 | 9,67872 |
| 75AS9 | 272 | 9,67633 |
| 75AZ3 | 274 | 9,74145 |
| 75GW3 | 283 | 9,71431 |
| 75Lsk | 276 | 9,96999 |
| 75LtR | 317 | 9,48274 |
| 75aeL | 319 | 9,70380 |
| 75fbP | 272 | 9,97063 |
| 75jnH | 325 | 9,73906 |
| 75jox | 272 | 9,86439 |
| 75qKS | 357 | 9,83422 |
| 75tf5 | 323 | 9,64068 |
| 77GlY | 317 | 9,43219 |
| 78F8r | 312 | 9,65525 |
| 78If9 | 273 | 9,67569 |
| 790kx | 277 | 9,78303 |
| 79Geu | 330 | 9,86993 |
| 79HNB | 359 | 9,79592 |
| 79zrY | 273 | 9,58872 |
| 7BV8F | 312 | 9,60394 |
| 7BaZh | 359 | 9,76098 |
| 7C2m9 | 317 | 9,38874 |
| 7DFim | 314 | 9,71560 |
| 7FbF0 | 362 | 9,55243 |
| 7QyJw | 324 | 9,63727 |
| 7RfIP | 317 | 9,50659 |
| 7RjfD | 326 | 9,81978 |
| 7RlzL | 311 | 9,77935 |
| 7RmCU | 324 | 9,77478 |
| 7Yrcx | 286 | 10,08861 |
| 7b9hr | 325 | 9,66666 |
| 7bcW8 | 319 | 9,43200 |
| 7bcXA | 314 | 9,63559 |
| 7bdA7 | 273 | 9,67749 |
| 7c8V9 | 272 | 10,02350 |
| 7c8WS | 275 | 9,71727 |
| 7c9Hy | 324 | 9,72643 |
| 7c9lQ | 325 | 9,70322 |
| 7cC2H | 312 | 9,67853 |
| 7cIuY | 315 | 9,60374 |
| 7cIxl | 323 | 9,72056 |
| 7cNaS | 277 | 9,80933 |
| 7cQuX | 317 | 9,36792 |
| 7cTdv | 322 | 9,93073 |
| 7cUAp | 272 | 10,04271 |
| 7cUB4 | 324 | 9,80237 |
| 7cVkl | 317 | 9,48274 |
| 7d3r5 | 312 | 9,59833 |
| 7d5v2 | 324 | 9,80772 |
| 7d7LS | 322 | 9,60181 |
| 7d8Mk | 312 | 9,60613 |
| 7dCyb | 275 | 9,83828 |
| 7dKyz | 358 | 9,73178 |
| 7dPew | 325 | 9,87464 |
| 7dVy2 | 317 | 9,27921 |
| 7da6Z | 272 | 9,98849 |
| 7dfhz | 317 | 9,37849 |
| 7dfow | 323 | 9,64049 |
| 7dm1C | 359 | 9,73178 |
| 7dm3n | 312 | 9,70309 |
| 7dnmt | 251 | 9,80804 |
| 7ejuL | 273 | 9,75486 |
| 7f2iD | 314 | 9,59343 |
| 7f2jT | 271 | 9,79238 |
| 7f2mv | 274 | 9,93485 |
| 7fJjy | 325 | 9,86000 |
| 7fUcK | 324 | 9,76420 |
| 7fUeW | 273 | 9,67769 |
| 7fUeb | 310 | 9,80237 |
| 7fdVc | 273 | 9,75466 |
| 7g774 | 272 | 9,93240 |
| 7g77U | 325 | 9,78645 |
| 7g7ar | 324 | 9,80256 |
| 7g7as | 273 | 9,71766 |
| 7gIwc | 314 | 9,84582 |
| 7gRVT | 315 | 9,85117 |
| 7goBX | 317 | 9,43219 |
| 7hiXG | 317 | 9,33143 |
| 7hic3 | 280 | 9,75860 |
| 7hsDo | 325 | 9,72623 |
| 7hz7k | 273 | 9,66299 |
| 7iaSo | 325 | 9,77355 |
| 7iaUd | 273 | 9,67614 |
| 7igVQ | 324 | 9,87947 |
| 7igYz | 314 | 9,65686 |
| 7jUKC | 312 | 9,56758 |
| 7kTk1 | 325 | 9,74390 |
| 7kToU | 324 | 9,57235 |
| 7kjCj | 313 | 9,70309 |
| 7kjzR | 360 | 9,73203 |
| 7kjza | 313 | 9,71927 |
| 7kmqh | 275 | 9,75163 |
| 7knFj | 272 | 9,98797 |
| 7knKk | 312 | 9,78322 |
| 7l8pT | 316 | 9,51852 |
| 7l8xK | 312 | 9,72823 |
| 7lBm2 | 359 | 9,83925 |
| 7ltUJ | 272 | 9,98765 |
| 7lyme | 279 | 9,82551 |
| 7lzjP | 322 | 9,66164 |
| 7lzrC | 272 | 9,72997 |
| 7mFU0 | 273 | 9,72978 |
| 7oaEY | 280 | 9,78329 |
| 7ol2E | 320 | 9,84092 |
| 7oo3w | 360 | 9,78574 |
| 7oo4v | 359 | 9,73178 |
| 7oqX5 | 237 | 6,75130 |
| 7p6wU | 273 | 9,71676 |
| 7p74A | 358 | 9,97089 |
| 7pdfb | 293 | 9,81565 |
| 7podf | 216 | 9,51742 |
| 7qENH | 272 | 9,88463 |
| 7qOk9 | 273 | 9,67569 |
| 7qPqq | 311 | 9,76749 |
| 7qPuG | 330 | 9,86993 |
| 7qQ1U | 280 | 9,77104 |
| 7qQ33 | 359 | 9,63527 |
| 7qQ8Y | 360 | 9,73203 |
| 7qyNI | 363 | 9,83912 |
| 7r72T | 359 | 9,85027 |
| 7r74D | 359 | 9,79612 |
| 7r75s | 335 | 9,96593 |
| 7rOXm | 330 | 9,79463 |
| 7re9C | 323 | 9,65254 |
| 7rrSp | 279 | 9,85014 |
| 7s2Cj | 466 | 9,69716 |
| 7sKJb | 381 | 9,01921 |
| 7sbMu | 405 | 9,68278 |
| 7scTJ | 351 | 8,05863 |
| 7scVo | 371 | 8,41140 |
| 7sy3x | 375 | 6,79291 |
| 7sy9G | 375 | 7,14247 |
| 7syek | 370 | 8,90117 |
| 7tcXR | 359 | 9,77871 |
| 7td1L | 312 | 9,65951 |
| 7tdas | 324 | 9,73700 |
| 7tdcm | 273 | 9,66299 |
| 7tdiW | 280 | 9,73719 |
| 7tdkj | 311 | 9,70895 |
| 7u5Gl | 312 | 9,65951 |
| 7u5I7 | 272 | 9,91184 |
| 7u5MR | 359 | 9,78567 |
| 7u5Zc | 311 | 9,73094 |
| 7uMQL | 324 | 9,74860 |
| 7uN1a | 323 | 9,64049 |
| 7v1IV | 330 | 9,77497 |
| 7v1sj | 326 | 9,83261 |
| 7v1z4 | 322 | 9,72501 |
| 7vELP | 344 | 9,60858 |
| 7vtbJ | 273 | 9,85556 |
| 7vtdU | 279 | 9,78387 |
| 7vth9 | 273 | 9,71656 |
| 7vthZ | 325 | 9,97682 |
| 7vtiW | 325 | 10,09544 |
| 7wsZK | 317 | 9,38913 |
| 7wt5M | 308 | 9,68562 |
| 7xM4s | 312 | 9,60613 |
| 7xM79 | 274 | 9,76852 |
| 7xMDB | 359 | 9,80662 |
| 7xMHn | 358 | 9,73165 |
| 7xMR3 | 312 | 9,63198 |
| 7xMya | 312 | 9,52722 |
| 7xNhZ | 322 | 9,77375 |
| 7xNjY | 325 | 9,72662 |
| 7xs9r | 311 | 9,74448 |
| 7xsah | 322 | 10,00467 |
| 7xsdZ | 325 | 9,74390 |
| 7xsjf | 322 | 9,76414 |
| 7xskd | 273 | 9,73016 |
| 7y7OG | 359 | 9,81256 |
| 7y8F0 | 279 | 9,80907 |
| 7y8PC | 279 | 9,93311 |
| 7y8x3 | 315 | 9,70844 |
| 7yCEB | 314 | 9,70844 |
| 7yCEj | 259 | 9,74403 |
| 7yCIw | 283 | 9,82577 |
| 7yCsx | 359 | 9,82854 |
| 7yCud | 280 | 9,77091 |
| 7yTNr | 273 | 9,85285 |
| 7yTXP | 272 | 9,93240 |
| 7yTYJ | 325 | 9,87896 |
| 7yU7r | 325 | 9,93975 |
| 7yUaw | 290 | 9,61618 |
| 7zDEw | 314 | 9,55668 |
| 7zDjn | 323 | 9,55243 |
| 7zDoW | 272 | 9,95767 |
| 7zDpW | 325 | 9,87490 |
| 7zDwX | 321 | 9,71521 |
| 7zDxS | 273 | 9,85884 |
| 7zeqG | 325 | 9,84924 |
| 7zpVq | 309 | 6,66883 |
| 80hpp | 371 | 8,54756 |
| 82rKZ | 351 | 8,33990 |
| 861Oh | 371 | 7,56188 |
| 86bDZ | 350 | 8,79041 |
| 8896F | 319 | 9,34432 |
| 8JtpO | 314 | 9,77329 |
| 8kcvM | 351 | 8,79054 |
| 8lpMN | 350 | 8,51332 |
| 8lqmh | 282 | 9,26135 |
| 8oC7y | 371 | 8,22754 |
| 8onmk | 371 | 8,00254 |
| CGG9 | 328 | 10,04954 |
| F64x | 357 | 9,00374 |
| ZoLS | 218 | 9,07220 |
| bZp | 273 | 9,70406 |
| h8J | 317 | 9,43187 |
| iLem | 320 | 10,06688 |
| l8Xr | 317 | 9,46733 |
| nheE | 264 | 9,12739 |
| oaUN | 278 | 9,59762 |
| A0A192Y8S8 | 276 | 8,83509 |
| A0A222Z2J4 | 275 | 8,63710 |
| W8CYX6 | 261 | 6,65661 |
| A0A1B1P7K2 | 263 | 8,34874 |
| A0A024B2H2 | 277 | 8,62692 |
| A0A173GCG8 | 278 | 8,84656 |
| A0A1I9S6X5 | 277 | 8,31399 |
| A0A514AA24 | 277 | 8,62692 |
| A0A6G9LR06 | 263 | 9,06356 |
| A0A7G5CHM1 | 348 | 9,80830 |
| W5QU70 | 277 | 8,64742 |
| A0A143FP66 | 277 | 8,62692 |
| A0A173H2G3 | 277 | 8,62692 |
| A0A222Z644 | 277 | 8,62692 |
| A0A385EA26 | 276 | 8,63710 |
| J9PU17 | 277 | 8,84656 |
| P89924 | 263 | 8,34874 |
| A0A9Y2DZ79 | 355 | 9,75453 |
| A0AAF0CJR2 | 247 | 8,77352 |
| D6QWL6 | 249 | 9,10850 |
| K4LP86 | 263 | 8,34880 |
| A0AAE9G9D8 | 247 | 9,76543 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_29138
7cEL4
|
14 | 51,9% | 327 | 2.193E-110 |
| 2 |
phalp2_11417
eYHn
|
21 | 51,4% | 202 | 5.888E-72 |
| 3 |
phalp2_29544
3KzTO
|
225 | 35,2% | 321 | 2.174E-58 |
| 4 |
phalp2_24835
7sl6i
|
39 | 28,5% | 427 | 2.331E-56 |
| 5 |
phalp2_29156
7qyOK
|
47 | 43,0% | 253 | 5.929E-51 |
| 6 |
phalp2_17898
EGF4
|
130 | 30,0% | 310 | 1.325E-49 |
| 7 |
phalp2_6450
8Jtqs
|
137 | 29,6% | 317 | 1.149E-41 |
| 8 |
phalp2_36904
7xR8d
|
63 | 32,0% | 293 | 2.519E-40 |
| 9 |
phalp2_8205
7kqpf
|
6 | 29,5% | 328 | 4.755E-38 |
| 10 |
phalp2_22268
7qxva
|
11 | 26,8% | 246 | 1.392E-32 |
Domains
Domains [InterPro]
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
uncultured phage [NCBI] |
278008 | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
CDS Source ID
CDS Source
HM011589
[NCBI]
CDS location
range 1 -> >591
strand +
strand +
CDS
ATGAGTATTAATGTAGTTAAGAATTTGGTGTCTTCAAGTAAATATAGTGTTAAGTGTCCTTATCCTATGAATCCAGAAATAATTGTCGTACACAATACGGCAAACGATGCATCGGCTAAGTCAGAAATTTCTTATATGATTAACAACAATAATGAAGTTTCCTACCATTTCGCTGTTGATGACAAAGAAGTTGTTCAAGGATTGCCATTAAATCGAAATGGTTGGCATGCAGGTGACGGTGGTTCGGGACGTGGTAACAGAAAAGGTATTGGAGTTGAAATTTGTTATTCTAAGTCTGGTGGTATTAAATATAAAAAAGCAGAAGTTTTAGCTATCAAATTTATTGCACAATTATTACATGAAAGAAATTGGTCAATTGATAGAGTAAAAACTCATAATCAGATGAATGGCAAGTATTGTCCCCATAGAATCCTATCTGAAGGAAGATGGGATGATGTACTACGAGCAATCCAAAAAGAGTTAGATAGATTAAATAATGTGGAAGTAAAACCTGCTCCAGATACTCAAGTGGATTCAGAAATAACAACTAAACCAAATAAACCAAAAGAAGAAAACAAAGTGGAATCAATT
Gene Ontology
| Description | Category | Evidence (source) | |
|---|---|---|---|
| GO:0001897 | symbiont-mediated cytolysis of host cell | biological process | None (UniProt) |
| GO:0008745 | N-acetylmuramoyl-L-alanine amidase activity | molecular function | None (UniProt) |
| GO:0009253 | peptidoglycan catabolic process | biological process | None (UniProt) |
| GO:0009254 | peptidoglycan turnover | biological process | None (UniProt) |
| GO:0030420 | establishment of competence for transformation | biological process | None (UniProt) |
| GO:0030435 | sporulation resulting in formation of a cellular spore | biological process | None (UniProt) |
| GO:0042742 | defense response to bacterium | biological process | None (UniProt) |
| GO:0071555 | cell wall organization | biological process | None (UniProt) |
Enzymatic activity
| EC Number | Entry Name | Reaction Catalyzed | Classification | Evidence | Source |
|---|---|---|---|---|---|
| 3.5.1.28 | None | Hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides. |
match to sequence model evidence used in automatic assertion
ECO:ECO:0000256 |
ARBA:ARBA00001561 |
Tertiary structure
PDB ID
upi0001d1d75a_model
Method
AlphaFold3 (non-commercial)
Resolution
-
Chain position
-
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50
The structures below correspond to the cluster representative
(7wtdu)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50