Protein
- Protein accession
- A0A3Q9R9W2 [UniProt]
- Representative
- 41TB1
- Source
- UniProt (cluster: phalp2_37267)
- Protein name
- Lysozyme
- Lysin probability
- 100%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MQLSSKGLEAIKFFEGYHSEVKNDNSVIPTIGYGTIRINGRPVTMGMKITAEQAEQYLLADVENYVGAQTK
- Physico‐chemical
properties -
protein length: 71 AA molecular weight: 7852,8 Da isoelectric point: 5,68 hydropathy: -0,31
Representative Protein Details
- Accession
- 41TB1
- Protein name
- 41TB1
- Sequence length
- 248 AA
- Molecular weight
- 26793,24530 Da
- Isoelectric point
- 5,02385
- Sequence
-
MLYIGVVEDRNDPLKLGRCKVRVIGLHTHDAAKLPTADLPWAVPMQPTTSAAISGIGTTPLGLVEGTSVIVMFRDDEKQFPIILGSIAGIPQSTSSDISSDDSTIRIKIDGELKQVNEQTNVLLDGSGNPVVDSSGAPVTTSQESVTLENANKLKRAVEYTPSANCVALIKRFEGLRLQAYQDSVGIWTIGYGTTRINGSPVQPGMIITEVQAEKYLSEDLKEFVPLVQRNTRALITQSMFDALCSFT
Other Proteins in cluster: phalp2_37267
| Total (incl. this protein): 18 | Avg length: 245,8 | Avg pI: 5,29 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 41TB1 | 248 | 5,02385 |
| 1AWqj | 319 | 4,83867 |
| 1Idqp | 275 | 5,07796 |
| 1MSDF | 350 | 4,63638 |
| 1qpxx | 282 | 6,11993 |
| 23078 | 302 | 4,53828 |
| 25vx7 | 261 | 5,76918 |
| 2fD7H | 243 | 4,24294 |
| 460Cf | 243 | 5,44332 |
| 4vQS7 | 212 | 4,99458 |
| 57boI | 226 | 6,90738 |
| 5bcJI | 318 | 5,43571 |
| 5gZiw | 224 | 5,82153 |
| 6BKnc | 224 | 4,92120 |
| 8ovNW | 237 | 5,44440 |
| ILVk | 204 | 5,68841 |
| SNDG | 185 | 4,66127 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_30923
SAFq
|
18 | 47,1% | 267 | 9.088E-81 |
| 2 |
phalp2_39833
SgIH
|
7 | 36,5% | 241 | 1.394E-48 |
Domains
Domains [InterPro]
No domain annotations available.
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Shigella phage vB_SflM_004 [NCBI] |
2500763 | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
CDS Source ID
CDS Source
MK295205
[NCBI]
CDS location
range 71400 -> 71615
strand +
strand +
CDS
ATGCAACTCTCAAGTAAAGGCTTAGAAGCCATTAAGTTCTTTGAAGGGTATCACTCAGAGGTTAAAAATGACAATTCTGTAATCCCTACAATTGGTTATGGTACAATTCGTATCAACGGAAGACCTGTTACGATGGGGATGAAGATTACTGCCGAGCAAGCTGAACAATATCTCCTTGCAGATGTTGAGAACTATGTAGGTGCACAAACAAAATAA
Gene Ontology
| Description | Category | Evidence (source) | |
|---|---|---|---|
| GO:0003796 | lysozyme activity | molecular function | None (UniProt) |
| GO:0009253 | peptidoglycan catabolic process | biological process | None (UniProt) |
| GO:0016998 | cell wall macromolecule catabolic process | biological process | None (UniProt) |
| GO:0031640 | killing of cells of another organism | biological process | None (UniProt) |
| GO:0042742 | defense response to bacterium | biological process | None (UniProt) |
Enzymatic activity
| EC Number | Entry Name | Reaction Catalyzed | Classification | Evidence | Source |
|---|---|---|---|---|---|
| 3.2.1.17 | None | Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. |
match to sequence model evidence used in automatic assertion
ECO:ECO:0000256 |
RuleBase:RU003788 |
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(41TB1)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50