Protein
- Protein accession
- A0A6B9WL40 [UniProt]
- Representative
- 8KTfD
- Source
- UniProt (cluster: phalp2_21078)
- Protein name
- Endoribonuclease RegB domain-containing protein
- Lysin probability
- 100%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MRKALLAGLLAISMMAHSSEHTFSNVQLDNMRYAYQFGEQFSKDGKYKTYKNIHKSGLGHIMAAILWQESSGGVNLKSKPKHHAYGMFQNYLPTMRARVKELGYNMTDAEIKRMLNKRSNSASWAYIELSYWLNIHKGDIRKAISSYNSGWNVKAGSKYASEVLEKANYLKNNKLLEIVND
- Physico‐chemical
properties -
protein length: 181 AA molecular weight: 20706,5 Da isoelectric point: 9,74 hydropathy: -0,55
Representative Protein Details
- Accession
- 8KTfD
- Protein name
- 8KTfD
- Sequence length
- 77 AA
- Molecular weight
- 9038,33190 Da
- Isoelectric point
- 9,58363
- Sequence
-
MDKSYSKRVVINKLESLRGGSKFAIHELEYWLDYHKGDLKKALASYNAGFKYTKKEARDYARMVNHTAKLLEEKQII
Other Proteins in cluster: phalp2_21078
| Total (incl. this protein): 154 | Avg length: 179,2 | Avg pI: 9,61 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 8KTfD | 77 | 9,58363 |
| 7BUL0 | 77 | 9,58363 |
| D9ICK0 | 77 | 9,58363 |
| A0A5Q2W6R0 | 182 | 9,66331 |
| A0A5C0CDQ9 | 204 | 9,65261 |
| A0A6B9XZM0 | 183 | 9,63024 |
| A0A2Z4QCS4 | 180 | 9,67653 |
| A0A3T0IME2 | 186 | 8,71717 |
| A0A2S1GQC1 | 181 | 9,76034 |
| A0A0M7QBV3 | 181 | 9,76034 |
| A0A6B9WR96 | 180 | 9,69729 |
| A0A192Y9R9 | 184 | 8,59894 |
| A0A240F378 | 139 | 9,90603 |
| A0A0G2SS69 | 186 | 8,41295 |
| E3SFK4 | 167 | 9,54237 |
| A0A6B9X0M0 | 179 | 9,52200 |
| A0A1J0GSF1 | 181 | 9,76034 |
| A0A0A0YVH4 | 182 | 9,46817 |
| A0A172Q184 | 179 | 9,52200 |
| A0A6G8RMY8 | 204 | 9,60523 |
| A0A5P8PHD2 | 181 | 9,56390 |
| A0A0A7HC85 | 179 | 9,59143 |
| A0A1V0DXM3 | 183 | 9,41549 |
| A0A1Z1LXH5 | 182 | 9,57944 |
| C4MZJ9 | 179 | 9,57306 |
| A0A0K1LKF3 | 179 | 9,54043 |
| E5E4C1 | 173 | 10,03046 |
| S5M388 | 181 | 9,76034 |
| A0A023W6J3 | 181 | 9,54218 |
| A0A088FS33 | 180 | 9,69729 |
| A0A7L4YF50 | 204 | 9,65261 |
| A0A7L4YHL4 | 204 | 9,65261 |
| A0A6G6XTK4 | 204 | 9,71643 |
| A0A7T3TKQ4 | 204 | 9,60523 |
| A0A2H4YFQ7 | 182 | 9,48415 |
| A0A5B9N0D1 | 180 | 9,69729 |
| A0A0A7HDR1 | 180 | 9,52161 |
| I7J3X6 | 183 | 9,41549 |
| A0A0A7HEH1 | 180 | 9,52161 |
| A0A0B6VTU9 | 183 | 9,65132 |
| A0A0K1LML3 | 182 | 9,41053 |
| A0A2U7NLU2 | 176 | 9,45024 |
| A0A0A7HFX4 | 180 | 9,52161 |
| A0A0M7QD78 | 181 | 9,78322 |
| A0A172Q1Z9 | 179 | 9,52200 |
| A0A2S1GP75 | 120 | 9,75473 |
| A0A2S1GRS7 | 179 | 9,54043 |
| A0A2Z5HKU3 | 205 | 9,71869 |
| A0A2Z5WKM3 | 181 | 9,71908 |
| A0A2Z6C8E4 | 204 | 9,65261 |
| A0A385IPB4 | 205 | 9,71869 |
| A0A386KLQ0 | 181 | 9,76034 |
| A0A3G2K911 | 204 | 9,65261 |
| A0A3G3MC21 | 180 | 9,69729 |
| A0A3T0ILR9 | 179 | 9,54043 |
| A0A410T4G0 | 179 | 9,54043 |
| A0A411BCJ6 | 205 | 9,71869 |
| A0A449C5U2 | 181 | 9,76034 |
| A0A482GH36 | 181 | 9,76034 |
| A0A482JPK4 | 185 | 9,52071 |
| A0A4D6BJX6 | 183 | 9,76536 |
| A0A4D6DX78 | 180 | 9,69729 |
| A0A513QBR4 | 204 | 9,71643 |
| A0A514U5M0 | 181 | 9,76034 |
| A0A5B9MV82 | 181 | 9,76034 |
| A0A5B9NGJ6 | 181 | 9,74744 |
| A0A5B9NNW5 | 182 | 9,64229 |
| A0A5C0CBB0 | 205 | 9,71869 |
| A0A6B9WKN3 | 196 | 9,92254 |
| A0A6B9XAL7 | 180 | 9,69729 |
| A0A6G8RLH4 | 205 | 9,71869 |
| A0A6G8RNC6 | 205 | 9,71869 |
| A0A6H0XAZ7 | 181 | 9,76034 |
| A0A6H1Z5X2 | 185 | 9,38803 |
| A0A6J3ZUW5 | 181 | 9,71908 |
| A0A7D5FJ75 | 181 | 9,76034 |
| A0A7D5FQ35 | 185 | 9,56919 |
| A0A7G3KB11 | 183 | 9,63024 |
| A0A7G3M6Z8 | 205 | 9,71869 |
| A0A7G5BCK5 | 180 | 9,52161 |
| A0A7I8N393 | 205 | 9,71869 |
| A0A7L8G427 | 205 | 9,71869 |
| A0A7T3N814 | 205 | 9,71869 |
| A0A7T3N930 | 205 | 9,71869 |
| A0A7T7CKT1 | 184 | 8,59894 |
| A0A7T7K7S7 | 181 | 9,74744 |
| A0A7T7K8J6 | 181 | 9,71908 |
| A0A7T8EI96 | 205 | 9,71869 |
| A0A7T8ELW5 | 205 | 9,71869 |
| A0A7T8EMA8 | 205 | 9,71869 |
| A0A7U0G943 | 184 | 8,59894 |
| A0A7U0GAG6 | 186 | 8,41140 |
| A0A7U3SR13 | 179 | 9,54043 |
| A0A7U3TBK5 | 180 | 9,60058 |
| A0A7U3WDN2 | 182 | 9,23170 |
| A8R9A7 | 179 | 9,59143 |
| D7RMB4 | 179 | 9,54043 |
| G1FH40 | 181 | 9,76034 |
| K4I4R4 | 204 | 9,67317 |
| Q56EQ6 | 183 | 9,69529 |
| S4TQ30 | 168 | 10,04754 |
| U5PYZ1 | 205 | 9,71869 |
| W8JF06 | 205 | 9,71869 |
| A0A140XB97 | 168 | 9,24575 |
| A0A193H0S3 | 120 | 9,69690 |
| A0A219Y9C6 | 139 | 9,90603 |
| A0A219YAI1 | 139 | 9,90603 |
| A0A219YD94 | 139 | 9,90603 |
| A0A240F3V1 | 139 | 9,90603 |
| A0A2P1JU92 | 130 | 10,14315 |
| A0A858HZG9 | 180 | 9,60058 |
| A0A868BQZ4 | 186 | 9,76859 |
| A0A873WLF5 | 181 | 9,48344 |
| A0A899ILY7 | 180 | 9,76034 |
| A0A8F1NHX4 | 180 | 9,60058 |
| A0A8F3HMA2 | 180 | 9,69729 |
| A0A8X8M4E1 | 162 | 9,57828 |
| A0A8X8MBL9 | 180 | 9,69729 |
| A0A8X8RHS6 | 162 | 9,57828 |
| A0A976S427 | 183 | 9,63024 |
| A0A976XMH5 | 182 | 9,64236 |
| A0A9E7MJ54 | 204 | 9,29977 |
| A0A9E7T0D4 | 162 | 9,57828 |
| A0AA49EIH5 | 181 | 9,56390 |
| A0AA49GZQ0 | 182 | 9,64236 |
| A0AA50FE94 | 180 | 9,69729 |
| A0AA51U8N0 | 180 | 9,57950 |
| A0AA94YNC8 | 183 | 9,70702 |
| A0AA94YPN6 | 183 | 9,70702 |
| A0AA94YRI3 | 183 | 9,70702 |
| A0AA94YS33 | 183 | 9,70702 |
| A0AA94YT89 | 183 | 9,70702 |
| A0AA95C6W9 | 183 | 9,70702 |
| A0AA96Q3Y1 | 181 | 9,76034 |
| A0AAD1QU57 | 179 | 9,61070 |
| A0AAD1QW41 | 179 | 9,61070 |
| A0AAE7MTY6 | 204 | 9,65261 |
| A0AAE7RLA2 | 180 | 9,69729 |
| A0AAE7RZK2 | 180 | 9,76066 |
| A0AAE7WG81 | 183 | 9,63024 |
| A0AAE8Z454 | 180 | 9,57950 |
| A0AAE8Z819 | 202 | 9,29977 |
| A0AAE9HJG2 | 77 | 9,66209 |
| A0AAE9HMW1 | 180 | 9,63720 |
| A0AAE9HN53 | 77 | 8,83083 |
| A0AAE9W5S7 | 204 | 9,65261 |
| A0AAF0FJK6 | 181 | 9,73822 |
| A0AAF1K0V3 | 181 | 9,64500 |
| A0AAX4R0F1 | 180 | 9,62341 |
| A0AAX4R0T1 | 180 | 9,67620 |
| A0AB38Z356 | 179 | 9,54043 |
| A0AB39U1S2 | 181 | 9,74744 |
| K4FBZ6 | 177 | 9,82132 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_31960
7PBFx
|
121 | 61,8% | 76 | 4.975E-36 |
| 2 |
phalp2_8837
2ABSl
|
1 | 28,5% | 70 | 1.383E-04 |
Domains
Domains [InterPro]
1
77 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Escherichia phage teqdroes [NCBI] |
2697536 | Straboviridae > Tequatrovirus > Tequatrovirus teqdroes |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
CDS Source ID
CDS Source
MN895438
[NCBI]
CDS location
range 161590 -> 162135
strand +
strand +
CDS
ATGAGAAAAGCACTACTCGCTGGTCTATTGGCCATTTCAATGATGGCACATAGCTCCGAGCATACTTTCAGTAATGTCCAACTCGATAACATGCGTTACGCGTATCAATTCGGGGAACAATTTTCTAAGGATGGAAAATATAAAACATACAAAAATATCCACAAGAGCGGATTAGGTCATATAATGGCAGCCATTTTATGGCAAGAAAGCTCTGGCGGAGTTAATTTAAAATCTAAACCAAAGCATCACGCCTACGGAATGTTCCAAAATTATTTGCCTACTATGCGAGCAAGAGTTAAGGAACTTGGTTATAATATGACCGATGCTGAAATAAAAAGAATGTTGAATAAACGATCCAATTCAGCTTCCTGGGCGTACATTGAGCTTTCTTATTGGTTAAATATACATAAGGGCGATATAAGAAAAGCAATATCCTCTTATAATTCGGGATGGAATGTTAAAGCAGGTTCTAAATATGCTTCTGAAGTCCTAGAAAAGGCTAATTACCTTAAAAATAATAAACTTTTGGAAATAGTAAATGACTAA
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(8KTfD)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50