Protein
- Protein accession
- sCVr [EnVhog]
- Representative
- 4i8lN
- Source
- EnVhog (cluster: phalp2_26894)
- Protein name
- sCVr
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MNKPQNIIVHHTLVSREKNPNQFEAVNDYHIRKGWGKIGYHYLIEADGTIKKGREETEEGAHTKEERMNYRSIGICLTGNFDEEEPTLEQCKALHSLITQTQNKYSIPDSRIYPHRHFTTYKSCWGNKLPNDVLGYLRMRIKGNDELEPWQKELFVWASEDIKDMKKLMDGNIWSILALVKRKLDKIK
- Physico‐chemical
properties -
protein length: 188 AA molecular weight: 22116,0 Da isoelectric point: 8,63 hydropathy: -0,84
Representative Protein Details
- Accession
- 4i8lN
- Protein name
- 4i8lN
- Sequence length
- 168 AA
- Molecular weight
- 19471,30190 Da
- Isoelectric point
- 9,55307
- Sequence
-
MSVEILKKQIAIITKLIKLYQMLLREILNKKVDVIIHHTATDRDRTSFEAINRGHKNRGYSQSSLGFYCAYNCLITGDGEEHWARSLDESGHATSAYKGFHIDICLCGNFMRERMSNKQIESLTKVLDRIKKKSGIKSLRGHRNYYPTLCPGQNLYNWMLENKGRFLN
Other Proteins in cluster: phalp2_26894
| Total (incl. this protein): 121 | Avg length: 184,2 | Avg pI: 8,95 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4i8lN | 168 | 9,55307 |
| 10ZIm | 176 | 9,55030 |
| 11D7B | 195 | 7,08625 |
| 13Utl | 211 | 8,83941 |
| 18IG | 270 | 9,57415 |
| 18UuZ | 168 | 10,36557 |
| 1HCGi | 188 | 9,03681 |
| 1OuGM | 172 | 9,22944 |
| 1XfVy | 217 | 8,35099 |
| 1gnaU | 215 | 8,16468 |
| 1l4Lk | 159 | 9,08097 |
| 1ldCU | 165 | 8,67069 |
| 1liDt | 185 | 9,08297 |
| 1lwPX | 179 | 8,41462 |
| 1nP6d | 209 | 9,73216 |
| 1oU64 | 182 | 9,09825 |
| 1otqF | 186 | 8,59004 |
| 1pnJR | 188 | 7,04840 |
| 25CId | 151 | 9,12674 |
| 2IAsE | 141 | 8,73361 |
| 2KWZA | 160 | 9,53483 |
| 2KZy3 | 185 | 9,85833 |
| 2Lq87 | 174 | 8,79221 |
| 2RVyF | 249 | 8,97414 |
| 2aZfy | 187 | 9,06060 |
| 2ce3U | 164 | 9,53876 |
| 2ce8Q | 196 | 9,70457 |
| 2ceh9 | 181 | 9,69471 |
| 2cmuq | 222 | 9,55500 |
| 2cxVo | 180 | 9,51581 |
| 2djTj | 174 | 9,43348 |
| 2dkT9 | 173 | 9,31409 |
| 2sIfW | 147 | 9,41582 |
| 2tJsh | 212 | 9,43045 |
| 2th5u | 161 | 9,21925 |
| 2tvRp | 184 | 8,78661 |
| 2txSn | 144 | 9,45211 |
| 2u1Os | 180 | 10,00693 |
| 2yCS3 | 152 | 7,75792 |
| 355IM | 179 | 9,69226 |
| 35B1D | 179 | 9,32885 |
| 36Inf | 143 | 9,26393 |
| 37Trz | 181 | 7,21175 |
| 37Wwq | 170 | 7,67056 |
| 3JUaM | 142 | 7,73916 |
| 3Qx4o | 195 | 8,96905 |
| 3Wj3 | 157 | 9,28076 |
| 3XgV | 181 | 7,26132 |
| 3Xo7u | 239 | 8,39793 |
| 3aTJH | 161 | 9,69438 |
| 3hnfv | 226 | 9,49066 |
| 3j8EL | 161 | 9,11243 |
| 3n8kr | 151 | 9,31795 |
| 3naUT | 184 | 8,77229 |
| 3nh4R | 159 | 9,63785 |
| 3sfF | 267 | 9,56983 |
| 41xke | 171 | 8,93965 |
| 42mcE | 196 | 7,05215 |
| 443o7 | 163 | 9,34303 |
| 45K27 | 176 | 9,36076 |
| 4BGnw | 248 | 6,00250 |
| 4BkH3 | 149 | 9,09773 |
| 4BylD | 170 | 9,30029 |
| 4Dt6W | 201 | 9,05840 |
| 4DuoC | 195 | 8,32301 |
| 4RCgz | 194 | 9,05428 |
| 4SvOM | 179 | 8,36782 |
| 4Ubtc | 199 | 7,72200 |
| 4Ut43 | 188 | 9,11062 |
| 4gKZv | 188 | 8,74444 |
| 4hDn9 | 177 | 9,51645 |
| 4hR3p | 164 | 9,49834 |
| 4hS90 | 155 | 9,31989 |
| 4hUu5 | 157 | 10,03633 |
| 4hXkY | 186 | 8,79325 |
| 4hYgY | 170 | 9,51413 |
| 4i5Bt | 177 | 8,93643 |
| 4i6jI | 173 | 9,19830 |
| 4i9bw | 174 | 9,70915 |
| 4iGjv | 183 | 10,22773 |
| 4igWU | 183 | 9,49466 |
| 4jAWY | 191 | 9,78574 |
| 4jq3x | 211 | 5,99892 |
| 4k0gQ | 182 | 8,60597 |
| 4qBQo | 192 | 9,02359 |
| 4veLv | 171 | 9,47983 |
| 4yEi1 | 164 | 8,27460 |
| 4zdjk | 179 | 8,96892 |
| 6GxC5 | 199 | 8,77790 |
| 7Ui4A | 189 | 9,32898 |
| 7ZRBf | 177 | 7,79985 |
| 7qRZT | 168 | 9,53644 |
| 80EBp | 212 | 5,98130 |
| 84Yx1 | 200 | 9,68826 |
| 85Occ | 172 | 9,67885 |
| 87DKw | 221 | 9,12416 |
| 89H08 | 215 | 6,49149 |
| 8dGjf | 221 | 9,38165 |
| 8iojL | 203 | 8,31470 |
| 8iqpy | 194 | 8,28311 |
| 8kwsM | 180 | 9,08077 |
| 8mE9x | 163 | 9,45327 |
| 8qprC | 229 | 8,36331 |
| 8reek | 246 | 9,02991 |
| 8s2Qm | 178 | 10,00416 |
| 8ti5O | 163 | 8,73065 |
| AaQ9 | 172 | 8,91348 |
| IrJM | 216 | 9,11404 |
| Isw4 | 168 | 9,25033 |
| Iszl | 203 | 9,23885 |
| UFDu | 167 | 8,82239 |
| UHNw | 176 | 9,48976 |
| WD2v | 197 | 9,34323 |
| fh5J | 180 | 9,11378 |
| fmIE | 176 | 10,13715 |
| hHY0 | 161 | 7,00963 |
| nLFU | 188 | 9,43567 |
| rA7D | 179 | 9,80372 |
| t4RV | 197 | 8,91651 |
| zv8Q | 165 | 9,43999 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_7337
4jq41
|
32 | 37,1% | 132 | 9.083E-52 |
| 2 |
phalp2_7876
8Bm2S
|
19 | 30,8% | 133 | 8.480E-48 |
| 3 |
phalp2_35354
7vHgi
|
29 | 33,8% | 127 | 5.226E-43 |
| 4 |
phalp2_25442
2RRxP
|
189 | 34,0% | 138 | 3.138E-41 |
| 5 |
phalp2_9648
1LmqP
|
34 | 25,1% | 143 | 1.106E-40 |
| 6 |
phalp2_40438
4hy1d
|
2 | 29,6% | 165 | 5.342E-40 |
| 7 |
phalp2_39380
4H4oF
|
116 | 31,5% | 133 | 2.151E-34 |
| 8 |
phalp2_28594
878Gz
|
18 | 30,0% | 133 | 1.420E-33 |
| 9 |
phalp2_8708
7YatT
|
2 | 26,5% | 147 | 8.469E-32 |
| 10 |
phalp2_7334
4iHo8
|
1 | 33,3% | 138 | 1.160E-31 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50
The structures below correspond to the cluster representative
(4i8lN)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50