Protein

Protein accession
q3hP [EnVhog]
Representative
1Db9K
Source
EnVhog (cluster: phalp2_31042)
Protein name
q3hP
Lysin probability
98%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
MKRIQLSPDFHLDEFTRSETATRHGISMAIPLGTDLHHNVTRLCVDLLQPMRDALGPTTILSGYRPLPLNRQLGSKDSSRHVLALAADLVVSGLSPFVVCTWYAQSRLPFDQVILEFGQWAHVALAPDGVEPRRQLLTAYRDPRAGVTVYRLGLYDIQELPA
Physico‐chemical
properties
protein length:162 AA
molecular weight:18098,6 Da
isoelectric point:7,01
hydropathy:-0,07
Representative Protein Details
Accession
1Db9K
Protein name
1Db9K
Sequence length
155 AA
Molecular weight
17483,51380 Da
Isoelectric point
6,33479
Sequence
LFPPNFTLADFTRSRTAKVRGIHNVPSETQERNLLRVAFFLHSLQVKLQKAGFRGDIWITSGFRNAELNKAVGGVDTSYHLRGLAADIVVSDMSPFQLASFIAEHMQEEGFEEIINERGRWVHFALAEQGEIPSREELTKTKSGYRLGIHEVGND
Other Proteins in cluster: phalp2_31042
Total (incl. this protein): 217 Avg length: 155,3 Avg pI: 7,89

Protein ID Length (AA) pI
1Db9K 155 6,33479
11o1g 157 7,01225
18AW8 157 6,29329
1AtJz 147 5,40513
1FaNW 145 5,02431
1I1Ge 153 7,00628
1JOfx 153 5,92071
1JQnb 157 6,22679
1JRIu 153 5,92719
1KDYS 152 6,05105
1Kajp 153 5,91406
1KbOh 141 7,74132
1MJup 153 5,92725
1T00Y 175 9,16929
1V6LN 161 6,74846
1WwKt 172 10,10847
1bLds 153 9,55997
1d6TT 141 6,57163
1fJ3H 161 6,83292
1fQ8z 137 7,08836
1fY4h 153 8,01008
1hVx8 161 6,74357
1jo9Z 154 7,02208
1loJ3 151 7,01475
1mrrN 153 9,65306
1pS43 148 9,23821
1rOJX 177 9,88876
1tRkx 160 8,81394
1wGsp 160 9,01792
1yAaZ 153 5,79231
1yDEN 152 5,60924
27m8K 90 8,93482
2AySX 160 8,78383
2B91s 175 9,25684
2CPN8 143 9,21725
2J22r 149 9,14421
2VBLm 163 6,53855
2Y7L9 149 8,73954
2aeKL 156 5,55342
2ahe6 168 9,85846
2cING 154 6,90551
2fLRL 206 6,92278
2lLcL 149 6,51371
2unAs 144 5,82284
2xjbJ 160 8,47406
2xxy7 171 9,87599
33cCc 149 5,93765
35HGA 154 5,18067
38j9D 153 5,39791
399eQ 163 6,70191
3A3QZ 139 8,25758
3CTVA 160 8,83038
3D0pU 161 9,39306
3HPHv 163 8,09795
3Ht8G 161 9,16523
3Hys4 161 7,70648
3Kbnx 154 9,35167
3QzH7 165 6,50820
3V4Gq 146 5,65505
3XgZ2 163 6,78967
3YPLK 153 6,41049
3ZpoA 163 8,20813
3aBnk 159 9,07136
3eppg 167 9,02656
3mLt1 177 9,72765
3ojTR 161 9,54095
3zU6Q 151 8,83992
44TrM 163 9,39242
44voj 145 8,92818
45ND0 171 10,27666
47SPE 167 9,87425
48xks 152 9,43670
49uFk 153 6,29392
4A8GQ 157 9,56152
4CA96 163 6,28516
4GeYY 153 5,91128
4K9HL 157 6,27198
4L5XK 149 9,21887
4Lc4D 146 9,57750
4NfAH 149 6,28568
4QlPy 172 9,85549
4RwXM 157 6,11914
4S1KH 161 9,16516
4U4IQ 146 5,50118
4UzzK 171 10,19311
4VH8D 161 8,69216
4W2Iv 171 10,19118
4XMk 171 9,99345
4YtYS 153 5,63277
4c8AA 171 9,82725
4c8Qt 168 9,29887
4dZVJ 173 8,31437
4eGub 153 5,92952
4f3Sw 141 6,27857
4f5e2 152 6,41419
4fRZQ 153 5,91406
4fysY 153 5,91406
4i5pk 123 6,17808
4ngYg 149 9,81262
4qSu3 159 9,74635
4rOAq 153 5,90440
4zYH3 154 9,19746
50P6v 153 5,80374
59w8 160 7,72717
5BUcQ 153 5,92071
5EHt7 121 5,53927
5EIej 153 6,28090
5HotW 147 6,40998
5Hzm2 121 7,93865
5K7aw 138 6,30358
5TdOT 139 6,28795
5a5Gi 153 5,61554
5eY1L 153 5,62987
5hgjl 166 6,96411
5kZ56 157 6,22997
5kzV7 152 5,90690
5lAW1 153 5,91406
5yRQ7 153 5,92071
5yXQJ 156 7,92679
5z3kO 149 9,17954
5zCNT 155 7,76929
5zHAg 153 5,91401
697C 150 8,74541
6APo3 157 6,11340
6Ae7Y 145 8,90697
6BXDd 153 5,90940
6IwJs 147 6,51337
6KWQk 157 6,11709
6LJXI 157 8,90542
6QfHU 171 6,90624
6QqNr 151 5,61964
6R6ZO 158 10,89124
6U2wF 157 6,29062
6Zp2S 172 10,12226
6kFhJ 138 6,30358
6wZqK 155 10,69223
71FIf 168 9,29558
79fon 149 8,68681
79gFH 149 8,73948
7DBrf 161 6,74357
7FVKi 153 5,91406
7FWqs 154 5,93146
7FY8U 152 6,07480
7VsBg 144 8,45485
7VtWM 157 8,37846
7YCF5 170 9,73603
7YbwK 161 8,79892
7YjdS 148 8,66921
7aYRX 149 9,18006
7b81D 170 9,21713
7hHGb 172 9,65306
7hsfW 146 6,90505
7htCD 149 8,73954
7lFUb 163 9,15936
7miDb 163 9,76021
7nEHw 155 10,81762
7nPqO 151 10,14908
7pbZt 152 9,12784
7pgvp 171 9,87599
7qKVD 151 10,14908
7qL0c 151 10,14908
7qWWT 149 8,73954
7qX3k 149 8,74045
7rqHl 172 10,32224
7sfqr 172 9,92273
7tfuE 149 7,89849
7vAvt 149 8,71305
7vK8k 138 5,64345
7vdnq 149 7,81494
7vzOe 151 9,50169
80MYu 153 5,92071
80nrK 150 9,40466
80oL5 154 9,64217
815wS 161 7,72643
82P4c 145 7,79386
85DKQ 153 5,90241
85DrD 144 5,67983
87YKn 154 9,59788
8AqkR 160 9,05492
8Avm6 161 9,54095
8DNze 149 8,55188
8Jkg5 149 8,97627
8dkiy 147 9,15053
8g6jP 160 9,05492
8gS9u 161 7,76417
8k8um 157 8,45524
8k9Ob 156 8,92805
8kIZ9 143 4,84816
8kKQd 161 6,84003
8kaj7 154 8,60113
8nZAG 153 6,74027
8qGo6 156 9,34219
8rk2d 170 9,73603
8s5xT 138 6,28403
8wdtf 149 8,88685
8xCDJ 149 7,01151
8zlbG 160 8,83038
97D1 152 6,83105
98ME 147 6,82730
Aohd 177 9,94742
I9zG 163 9,58698
IjbW 153 9,93382
J2zk 125 9,23221
KxzY 172 9,83995
O5Bl 172 9,06885
VWbZ 164 9,35322
YU8M 163 6,74977
ZFd2 153 6,03456
aJj4 152 8,85443
cbQc 175 9,85517
gFvs 144 4,92165
iiCZ 161 10,11511
qKpP 157 9,98959
qXZ5 161 8,48915
rrWH 160 8,79834
z0Bf 149 9,07878
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_30101
38zFk
347 39,2% 158 3.173E-57
2 phalp2_37718
4e1ey
787 39,4% 152 1.537E-56
3 phalp2_38153
6WaM5
59 39,2% 163 2.722E-52
4 phalp2_1343
17yCd
10947 34,2% 152 1.497E-49
5 phalp2_8264
3Vy7
8 39,1% 143 2.329E-47
6 phalp2_16310
5cNwZ
30 36,6% 150 1.546E-46
7 phalp2_21393
3LPeU
1997 34,4% 151 1.058E-42
8 phalp2_23143
4GhkT
33 32,2% 155 2.724E-42
9 phalp2_8904
3b8fO
2682 33,3% 147 2.476E-41
10 phalp2_21836
4mpYp
274 23,6% 169 8.741E-41

Domains

Domains
Representative sequence (used for alignment): 1Db9K (155 AA)
Member sequence: q3hP (162 AA)
1 155 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF08291

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1Db9K) rather than this protein.
PDB ID
1Db9K
Method AlphaFoldv2
Resolution 96.37
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50