Protein
- Protein accession
- jNib [EnVhog]
- Representative
- 4R5T
- Source
- EnVhog (cluster: phalp2_14868)
- Protein name
- jNib
- Lysin probability
- 99%
- PhaLP type
-
VAL
Probability: 91% (predicted by ML model) - Protein sequence
-
MQKIFNKDGFNWWIGVVENRQDPEKLGRCKVRIFGYHTDSKELLPTKDLPWCIPIQPITSAATSGLGSSPLGPVEGTWVIGFFLDGEDMQQPAMFGTIATKAAKQAFAAQSAESKPREETNNPNDGVLKDGQGKPVTDGQGEPVRAGTPKIDGWELGKTSEKYESGGKGPGVINDYSGAAEGDLGGASYGTYQLASFLPEMRKNGKARPSAKNSPVEQFIKNSKFKDKFTDLTPATPEFDTKWKEVAAQNTKEFKDDQHDYIQRKYYNVMTANLQRAGLDLSKYGPGVQDLVWSTAVQFGPARVSIFTEPLRNKSELSDKDIINLVSDYKIAKVDELFKSSSENIRAGVKSRYQSEKQALLALVKS
- Physico‐chemical
properties -
protein length: 366 AA molecular weight: 40305,9 Da isoelectric point: 8,23 hydropathy: -0,64
Representative Protein Details
- Accession
- 4R5T
- Protein name
- 4R5T
- Sequence length
- 370 AA
- Molecular weight
- 40839,94470 Da
- Isoelectric point
- 6,64552
- Sequence
-
MNKIFNSDGFIWFVGVVENRDDPEKLGRCKVRVYGYHSEIKVDLPTEDLPWAIPISPITSASISGIGTTPIGPLPGTWVVGFFLDGSDMQQPAFFGTIGTKSAPISYKRKDSKQPLNNRNDGNLKDQNGFDITDANGFNLKTGNKFIQNFDIKNVSSTSTISTQFGLGTGSKTVSYVNEYQTTEDKNGARYGKYELSSFLPAKTPLGVSRPTSKGSPLNSFLSKSKFNVQFEGLVPGTDSFDNKWSEISSNNQDSFEKDQDDFIKRNYYDSMVSNLKRRGIDLTKFGPSVQSLAYTTSLQSGPVGGASIFFKSLEGKSKLTDSDIVSNVNEYKINNASQIFSNLNSEDLKNLNNDLLNQKNSLNNLLPDF
Other Proteins in cluster: phalp2_14868
| Total (incl. this protein): 133 | Avg length: 365,5 | Avg pI: 7,21 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 4R5T | 370 | 6,64552 |
| 15dPo | 358 | 5,88922 |
| 17Zrr | 358 | 8,16216 |
| 183E4 | 359 | 8,64239 |
| 18Eki | 361 | 8,33829 |
| 18FeN | 361 | 8,25519 |
| 18brW | 361 | 8,59571 |
| 18kfs | 363 | 5,88320 |
| 18o0B | 361 | 8,62221 |
| 18w4N | 361 | 8,77500 |
| 1AE4R | 359 | 6,21798 |
| 1AEGa | 372 | 6,86191 |
| 1DL1U | 359 | 8,44924 |
| 1GZtU | 361 | 7,69363 |
| 1JIX9 | 361 | 8,79305 |
| 1JsZk | 359 | 5,48283 |
| 1OC2x | 361 | 6,77415 |
| 1PcvT | 360 | 5,24018 |
| 1Pdqt | 360 | 5,42314 |
| 1XSq1 | 384 | 8,33152 |
| 1fgW3 | 280 | 6,84679 |
| 1h5id | 361 | 7,68340 |
| 1ha0T | 361 | 7,66209 |
| 1iE3T | 359 | 6,76938 |
| 1iocs | 360 | 5,86996 |
| 1mR1P | 359 | 6,23208 |
| 1xNfB | 361 | 8,60455 |
| 1yjGE | 363 | 5,89741 |
| 22P17 | 358 | 6,77898 |
| 27Bsr | 361 | 8,24817 |
| 27iwQ | 369 | 5,53273 |
| 28710 | 361 | 8,60442 |
| 2cXPo | 361 | 4,96832 |
| 2d313 | 359 | 5,89553 |
| 2hGc4 | 361 | 8,79305 |
| 2hKgZ | 361 | 8,84224 |
| 2hUf7 | 361 | 8,81181 |
| 2hVW0 | 361 | 8,63143 |
| 2hzfd | 361 | 8,95184 |
| 2iCuO | 359 | 6,78512 |
| 2iEd1 | 366 | 8,51287 |
| 2isOh | 372 | 5,39552 |
| 2ivNr | 370 | 8,88750 |
| 2izYN | 361 | 6,24862 |
| 30UlF | 279 | 5,33692 |
| 31H4a | 265 | 9,08374 |
| 31KtV | 362 | 6,85691 |
| 31OBm | 361 | 8,34719 |
| 32VZ4 | 361 | 8,37485 |
| 32WRy | 361 | 8,64104 |
| 3CYNf | 445 | 5,25251 |
| 3DOfB | 446 | 5,33180 |
| 3VRy7 | 365 | 6,05707 |
| 3b9oT | 361 | 7,63259 |
| 3esiW | 350 | 7,64527 |
| 484G1 | 358 | 8,45208 |
| 49ePa | 363 | 8,15913 |
| 4UvoS | 363 | 9,02391 |
| 4acDx | 359 | 5,59002 |
| 4f6On | 362 | 8,11517 |
| 4f7cw | 362 | 8,59365 |
| 51KB | 412 | 5,01083 |
| 51a0e | 365 | 7,72137 |
| 51ymF | 361 | 8,65096 |
| 53KVE | 367 | 8,65896 |
| 54Py6 | 361 | 8,61325 |
| 552m1 | 361 | 8,62240 |
| 55A60 | 361 | 8,34725 |
| 55qXc | 361 | 8,34712 |
| 5AKl0 | 361 | 8,62240 |
| 5DcvS | 359 | 5,90139 |
| 5Dh8Z | 366 | 8,70969 |
| 5ODr | 360 | 8,88550 |
| 5eIlq | 361 | 8,61325 |
| 5f9aG | 361 | 8,62240 |
| 5gPFn | 361 | 8,32985 |
| 5gV2k | 289 | 7,15833 |
| 5j6CO | 367 | 5,15953 |
| 5o6FF | 352 | 6,85742 |
| 5u2JE | 367 | 6,37383 |
| 5u97c | 361 | 8,54201 |
| 6GRNd | 360 | 5,86996 |
| 6GS43 | 361 | 5,67494 |
| 6LXSC | 370 | 8,37910 |
| 6MdCe | 370 | 7,66055 |
| 6MeiQ | 365 | 7,73251 |
| 6Mk1r | 374 | 8,47838 |
| 6MqsU | 361 | 7,65777 |
| 6xDDA | 365 | 8,48734 |
| 6z89I | 361 | 5,67511 |
| 6zvQz | 374 | 6,37929 |
| 7HA49 | 411 | 5,01220 |
| 7HFSc | 446 | 5,30782 |
| 7HQfO | 360 | 5,74440 |
| 7HzGj | 370 | 6,03490 |
| 7XfB9 | 283 | 8,77287 |
| 82WKc | 362 | 7,71103 |
| 82WVp | 360 | 5,33698 |
| 82Xoq | 356 | 6,78160 |
| 83nF2 | 368 | 7,72728 |
| 8AXig | 411 | 5,01220 |
| 8B1jz | 361 | 6,77171 |
| 8CIpK | 397 | 4,87147 |
| 8CWKU | 448 | 4,96428 |
| 8DFeQ | 445 | 5,25251 |
| 8FIYd | 446 | 5,22483 |
| 8iJO | 360 | 8,98182 |
| 8oUE4 | 361 | 8,89440 |
| 8pSha | 445 | 5,44503 |
| 8r6ST | 361 | 6,77671 |
| 8r9ae | 368 | 6,02854 |
| 8wcrd | 412 | 5,01083 |
| 8xcOS | 446 | 5,33180 |
| B6eT | 361 | 8,68107 |
| Cfgw | 360 | 5,86996 |
| G9eG | 361 | 7,66590 |
| IJec | 362 | 7,58536 |
| KWc1 | 362 | 7,67073 |
| L4s4 | 364 | 5,78652 |
| MiHX | 361 | 7,61804 |
| RT39 | 361 | 8,62221 |
| SRtO | 323 | 6,85088 |
| SuQl | 361 | 8,64104 |
| SuiA | 361 | 8,67095 |
| U8ko | 361 | 8,30503 |
| Ugza | 352 | 7,85349 |
| Uqko | 361 | 6,77210 |
| XGhU | 354 | 5,19863 |
| jKUa | 357 | 4,79775 |
| jS0j | 365 | 6,78427 |
| jXcl | 360 | 5,60475 |
| uaSV | 372 | 8,21600 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_8634
27DXq
|
1 | 49,4% | 251 | 2.829E-136 |
| 2 |
phalp2_5108
1KGN1
|
5 | 30,1% | 361 | 8.066E-84 |
| 3 |
phalp2_17991
1fsJo
|
7 | 35,1% | 481 | 1.839E-82 |
| 4 |
phalp2_38452
1gaWs
|
21 | 16,0% | 598 | 5.053E-24 |
| 5 |
phalp2_34756
3gDxq
|
18 | 17,8% | 235 | 1.669E-16 |
Domains
Domains
No domain annotations available.
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(4R5T)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50