Protein
- Protein accession
- hpL [EnVhog]
- Representative
- 6H1JM
- Source
- EnVhog (cluster: phalp2_8114)
- Protein name
- hpL
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MPSGGLMSTAVAVLDVARAELGTAESPIGSNRVKYNAWFYGREVSGDAYPWCAVFVSWVAITAGASALIPRHAYTPAGADWFRQRGAWGSTPRVGAIVFYEWPGMGRISHVGIVETVHPDGSWTAIEGNTDAAGSRTGGQVMRQRRRSVGARGGFGYPAYAAAAAATPVPAPAAGRPTLRRGDTGGHVQALQQRLRTAYPAYAGHLVVDGDFGPATEAAVREFQRRSRLDVDGVVGRNTWRALGLAT
- Physico‐chemical
properties -
protein length: 247 AA molecular weight: 26139,1 Da isoelectric point: 10,13 hydropathy: -0,16
Representative Protein Details
- Accession
- 6H1JM
- Protein name
- 6H1JM
- Sequence length
- 250 AA
- Molecular weight
- 26521,62030 Da
- Isoelectric point
- 4,51128
- Sequence
-
MSGVNAMLAECEKWVAAGFVEGPGNNETPFGAWYGDQYEPWCDQFVSYAGATSGNGDAVGKFQYCPSHVNWFKSRGQWGGSPQVGALVFYDWNGDGAADHVGIVVSFDDNAITTYEGNTSSGDAGSQSNGGGAYQRTRPRNGLILGYGYPAYPADAPAPQQPAPAPAAAPAGPAWPGEYLSVQSPMLHDDNVRTWQQHMADRGWEISADGWYGNKSRSVCAAFQTEKGLGNDGIVGPVTWAATWNAPVTP
Other Proteins in cluster: phalp2_8114
| Total (incl. this protein): 136 | Avg length: 265,8 | Avg pI: 8,39 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 6H1JM | 250 | 4,51128 |
| 11qNC | 257 | 9,20011 |
| 137s | 265 | 8,57238 |
| 14UK8 | 269 | 9,87573 |
| 1Jeww | 242 | 8,99581 |
| 21t9c | 282 | 9,41975 |
| 2PSJp | 328 | 8,63059 |
| 2WTBc | 345 | 9,55423 |
| 2WTus | 268 | 9,67047 |
| 2WTyX | 266 | 9,69606 |
| 347y | 253 | 9,50253 |
| 3MDbE | 254 | 10,33752 |
| 3bYUQ | 244 | 9,41304 |
| 3ca7G | 328 | 10,14122 |
| 45oWy | 244 | 9,41820 |
| 4EWJd | 233 | 9,64861 |
| 4NfYl | 188 | 9,00032 |
| 4eI2Y | 263 | 9,44702 |
| 4gSpW | 271 | 9,91674 |
| 4k3cH | 242 | 9,28559 |
| 4r47n | 260 | 10,15301 |
| 5BBQJ | 273 | 8,83160 |
| 5BCjp | 260 | 9,72088 |
| 5Bo7l | 251 | 8,64013 |
| 5hTFQ | 367 | 9,84962 |
| 5iqVS | 257 | 9,00560 |
| 5kpfc | 259 | 10,15314 |
| 5nNXx | 329 | 8,28021 |
| 5nO48 | 326 | 5,95806 |
| 5qRqg | 299 | 8,43854 |
| 5qTt7 | 301 | 9,68091 |
| 6CAIn | 327 | 7,67386 |
| 6CBOE | 255 | 9,41601 |
| 6CKJN | 319 | 6,43346 |
| 6CLdq | 325 | 6,43795 |
| 6CM2j | 315 | 7,04914 |
| 6DFHf | 323 | 8,60461 |
| 6DgSd | 236 | 7,09461 |
| 6DpOm | 251 | 9,19160 |
| 6Dz7p | 258 | 9,23253 |
| 6E2j7 | 246 | 9,59111 |
| 6EFjw | 327 | 7,71285 |
| 6EL7B | 258 | 9,30048 |
| 6EkUa | 244 | 5,87558 |
| 6EpGN | 323 | 7,08716 |
| 6EqiX | 325 | 6,95297 |
| 6Es5m | 250 | 4,40186 |
| 6Ewmc | 330 | 9,14382 |
| 6EycG | 247 | 4,65184 |
| 6FcWk | 253 | 5,68801 |
| 6Felg | 324 | 7,08000 |
| 6H2WP | 322 | 8,29368 |
| 6IYSx | 334 | 9,58679 |
| 6IYwA | 246 | 9,40550 |
| 6J7wa | 246 | 9,40563 |
| 6KqD5 | 244 | 9,47584 |
| 6KsSU | 332 | 9,57383 |
| 6RZrV | 253 | 5,47294 |
| 6T8fg | 272 | 9,55146 |
| 6TKBg | 228 | 9,02920 |
| 6U8DI | 268 | 5,40456 |
| 6UxUR | 238 | 6,71157 |
| 6W6PB | 241 | 9,44992 |
| 78IjA | 249 | 10,04748 |
| 78j4m | 235 | 5,47248 |
| 7F4ei | 205 | 9,75460 |
| 7Vues | 261 | 10,19524 |
| 7fGHE | 330 | 9,82571 |
| 7gCF5 | 243 | 9,27921 |
| 7gCsm | 268 | 5,41581 |
| 7gCww | 256 | 9,79399 |
| 7jp4Z | 246 | 4,78376 |
| 7k4Sr | 332 | 8,70576 |
| 7lE8Q | 245 | 9,50124 |
| 7lavs | 244 | 9,32131 |
| 7nGFI | 240 | 4,53356 |
| 7o6L5 | 248 | 4,50957 |
| 7o6Zo | 252 | 9,28346 |
| 7og0 | 279 | 5,66494 |
| 7oirJ | 274 | 5,67193 |
| 7pl3x | 241 | 4,70305 |
| 7ppXv | 250 | 9,19869 |
| 7ref3 | 289 | 4,96406 |
| 7rfj4 | 247 | 4,66764 |
| 7sfui | 246 | 9,60587 |
| 7tMGR | 247 | 8,89975 |
| 7tMQA | 247 | 7,80495 |
| 7tMp3 | 242 | 8,55039 |
| 7tMrV | 332 | 9,83157 |
| 7uBPh | 238 | 9,59865 |
| 7uPJ1 | 247 | 8,47471 |
| 7uaJX | 255 | 9,83841 |
| 7udG5 | 255 | 9,70386 |
| 7udQT | 232 | 9,26690 |
| 7udrc | 231 | 6,29835 |
| 7uiVR | 241 | 9,06040 |
| 7uiap | 330 | 9,97205 |
| 7ujLZ | 253 | 9,72597 |
| 7ujNF | 236 | 9,47165 |
| 7ujWC | 248 | 9,99365 |
| 7ujWe | 235 | 9,29700 |
| 7ujYI | 256 | 5,13355 |
| 7uk1D | 240 | 9,19379 |
| 7uk2b | 245 | 9,66615 |
| 7umb6 | 250 | 9,53960 |
| 7umc5 | 263 | 8,44937 |
| 7umdM | 253 | 6,53293 |
| 7v1m6 | 248 | 9,61354 |
| 7vNfx | 246 | 8,89678 |
| 7vNie | 245 | 7,07437 |
| 7vxw8 | 343 | 6,32194 |
| 7w8r7 | 269 | 8,86307 |
| 7wB4c | 282 | 7,72984 |
| 7wkAb | 251 | 8,67024 |
| 7wkbl | 233 | 8,46472 |
| 7wkcV | 269 | 9,57228 |
| 7wknt | 259 | 9,51142 |
| 7wktg | 247 | 5,90252 |
| 7wmIt | 275 | 9,43961 |
| 7yGrK | 260 | 9,44805 |
| 7ynUB | 257 | 9,19933 |
| 7ynVj | 248 | 9,76259 |
| 7zGpA | 279 | 9,28108 |
| 7zGsq | 240 | 5,93526 |
| 7zcEi | 233 | 9,31995 |
| 7zeTs | 245 | 8,79699 |
| 7zht5 | 241 | 9,27882 |
| 8IImy | 275 | 9,31563 |
| 8rXfa | 263 | 8,34313 |
| 9S0Z | 265 | 9,48718 |
| QHoM | 251 | 6,29153 |
| guID | 244 | 7,21494 |
| hBV | 260 | 9,03739 |
| iX1P | 261 | 9,38577 |
| uiaB | 225 | 9,25478 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_33085
4F3tD
|
1 | 38,9% | 249 | 2.382E-67 |
| 2 |
phalp2_29160
7s0gR
|
24 | 38,0% | 268 | 1.035E-62 |
| 3 |
phalp2_35099
5iIaS
|
1391 | 33,0% | 254 | 1.248E-52 |
| 4 |
phalp2_1959
4y5vj
|
188 | 30,6% | 232 | 1.073E-45 |
| 5 |
phalp2_35707
3PU5B
|
16 | 24,7% | 303 | 1.466E-45 |
| 6 |
phalp2_14320
3VFlX
|
143 | 28,9% | 252 | 3.746E-45 |
| 7 |
phalp2_25577
3Q2DF
|
166 | 27,6% | 264 | 1.308E-44 |
| 8 |
phalp2_11549
ZJ7o
|
17 | 42,0% | 157 | 1.594E-43 |
| 9 |
phalp2_16018
3yVVm
|
206 | 39,3% | 160 | 8.224E-41 |
| 10 |
phalp2_15061
7ubMN
|
176 | 30,7% | 273 | 3.914E-40 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(6H1JM)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50