Protein

Protein accession
fhQ7 [EnVhog]
Representative
5elq8
Source
EnVhog (cluster: phalp2_6108)
Protein name
fhQ7
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MSGSHSTGAVTTKIILPLVVMALFLAGAVMQYRSVRSAERTDALRAPAPRSAELVLPLAPPPAVSSTTAAPTPTRAPARLTTKPSPRKSASPFKSAAPVTRMAVGAIQQYAASLVGSSYEFTCLAHIIDHESGWNPHAGNPDGSYGVPQSLPGAKMSSEGADWRDNPKTQLRWMIKYIHSRYGTPCDAWAWWQRHSWY
Physico‐chemical
properties
protein length:198 AA
molecular weight:21398,2 Da
isoelectric point:9,89
hydropathy:-0,26
Representative Protein Details
Accession
5elq8
Protein name
5elq8
Sequence length
154 AA
Molecular weight
17919,20500 Da
Isoelectric point
9,58472
Sequence
MKKEKGYKAPNNGRKIRRLKFYLALSLTALITLATPLTGVHTASVNDAKVESMKVSDPKQYARSIAQEQYGWNSEQHKCLGILWGKESAWNFQAASPTQDYGIPQRHMRKNTQEEIDAFMKNPQTQIKWGLNYIEKRYGSPCEAWEFWSVNRWY
Other Proteins in cluster: phalp2_6108
Total (incl. this protein): 169 Avg length: 145,6 Avg pI: 9,54

Protein ID Length (AA) pI
5elq8 154 9,58472
12FpN 152 9,98198
12Imx 157 9,96399
12KEE 177 9,97437
14lZT 153 10,23888
157DD 119 9,96264
17PrP 112 10,20317
1811l 154 9,75872
185NU 136 9,96483
18I09 154 9,26077
18KMB 145 9,07588
18a3N 146 9,72978
19Qzj 146 10,11388
19Sck 145 9,20520
19Sge 152 10,16668
19zRk 119 6,73215
1JZ8x 140 10,08977
1Jn8G 174 10,03819
1JweI 151 9,18476
1O0ye 140 9,75357
1OwYg 153 10,46394
1YO3R 156 10,04993
1YPa3 140 10,00119
1iJuS 157 9,16549
1kzmh 174 9,93762
1wpKQ 132 6,89749
1wpdj 139 10,00938
20vc4 178 10,58366
2810D 143 10,31728
286ac 139 10,00938
2DUtF 178 10,58740
2EbcD 155 10,05521
2ElRl 102 9,80579
2cWAL 151 8,84740
2hGGp 156 10,24662
2hIy9 150 10,20427
2hMVg 174 9,90700
2hTEd 153 8,50314
30ykY 150 10,02530
30zBJ 154 10,09332
311R0 97 10,06585
313uJ 152 10,07475
316ZZ 153 10,02440
31nXf 152 9,93692
31q3j 126 9,96715
31x3Z 132 9,32685
362g4 116 10,44273
36XQa 155 10,06140
37AKe 133 8,53415
37BOs 157 7,73950
38hXA 154 8,81439
38lms 167 10,07127
38qOl 154 8,46278
3WuDu 119 9,72855
3b1Ie 159 10,08680
3b8ts 153 10,21677
43LcU 153 9,27321
44FmV 152 10,12561
44p2v 152 10,29284
46SSh 136 9,97218
46tIN 145 9,07594
46tJY 132 6,41555
471wp 155 9,96477
474rj 157 9,84060
475rb 141 11,00619
476HK 136 10,01866
47Hm9 151 10,02717
47bN9 166 10,29059
47msr 157 9,84060
47mxv 161 9,97921
47pWw 153 10,35989
47ufp 119 9,94884
47zJf 153 5,58229
480Lt 155 10,00777
487t5 150 9,93692
48FxH 110 9,96174
48W6Q 127 10,19750
48X8Q 163 10,05251
48k0r 153 10,32837
496N3 137 9,97134
498I2 103 10,25300
4AeB0 152 10,12671
4IZ4f 109 10,25300
4J5vW 136 9,87818
4Je1k 163 9,97553
4NJFs 152 10,20723
4Rr6D 153 6,73829
4aEAT 129 7,74405
4aZPG 148 8,54665
4b9tN 136 10,20730
4bD7J 115 10,28930
4bEza 153 10,13664
4bFjx 156 10,08964
4bGZ9 154 10,01950
4bUZ0 156 10,25945
4bxll 148 10,02820
4e9m9 174 10,00673
4ecC2 132 9,37636
4rlxa 155 10,08010
4rmK4 149 10,20723
56EQ8 167 9,92492
56skU 177 9,56796
57pJ1 130 10,12897
5AD0V 119 9,76337
5BX8A 146 7,74337
5Btki 114 10,05760
5aEeY 135 7,80308
5dhC8 143 9,20578
5eJzT 140 9,96999
5kAeE 141 8,75940
5kG8A 176 9,89508
5lI5C 174 9,03681
5mdgJ 151 6,82667
5tLP5 135 7,79341
5wkkx 153 9,61012
5wrQ2 135 7,76718
5xU6y 135 8,55110
6A6XJ 119 9,96477
6Au2d 155 10,17422
6Ggwj 140 9,97418
6GlZK 135 10,00712
6IsBZ 135 9,66486
6Isnv 139 10,21942
6L0Ib 139 10,03974
6L2l8 155 9,39390
6MDRk 176 9,39519
6MEby 177 9,91364
6McFY 119 9,66035
6Mepb 119 9,96870
6QAmD 159 10,08197
6x84q 135 6,95859
6zkmR 135 6,89851
6zywh 119 9,86664
7VyN0 162 9,93466
7XHRi 144 7,73376
7XItu 129 7,72848
7XajE 139 10,00938
7xYC 127 9,75711
83cY6 176 9,22622
87lyt 110 7,74058
87m13 179 10,23237
87uvr 132 6,90084
88fOL 145 10,13335
892hS 118 9,72958
892iL 139 10,08197
89jl3 129 7,75718
8F7sm 144 8,90503
8eJCB 137 5,80141
8oSYv 122 9,84885
8r9US 162 9,87419
8stad 152 9,76820
8t45S 151 8,50262
8vsEE 136 10,07700
Ccj2 134 9,65957
Ghej 173 10,00673
GzBS 131 9,80353
H1vs 160 10,04986
J7BY 130 10,12897
RV8q 155 10,13664
TOo9 134 9,75692
TOxr 132 10,25088
TaHR 136 10,09080
TaKI 139 9,96328
Ujf6 152 8,79943
cVBe 155 9,88927
hBW 190 10,09712
mIcE 155 9,96870
x70D 139 10,08197
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_28855
57haC
91 51,8% 106 1.262E-41
2 phalp2_38619
2aAe3
5 39,2% 102 9.738E-36
3 phalp2_2932
U3n1
1044 42,3% 104 4.273E-34
4 phalp2_14148
2iIxu
157 36,4% 137 4.273E-34
5 phalp2_28896
5ouYs
43 33,8% 139 5.855E-34
6 phalp2_34714
34bhd
418 30,0% 143 1.698E-31
7 phalp2_33229
5nuDD
24 31,6% 101 5.986E-31
8 phalp2_35084
5danD
7 39,2% 107 2.890E-30
9 phalp2_17166
32AjW
63 38,6% 101 4.448E-28
10 phalp2_5853
5tr9z
1185 37,1% 97 1.566E-27

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 5elq8 (154 AA)
Member sequence: fhQ7 (198 AA)
1 154 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (5elq8) rather than this protein.
PDB ID
5elq8
Method AlphaFoldv2
Resolution 80.65
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50