Protein

Protein accession
dV4c [EnVhog]
Representative
1fKSs
Source
EnVhog (cluster: phalp2_5007)
Protein name
dV4c
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MTQRFEPGKLLDFFTYFDPSNKFHLDAVNLLQEECQALDPDVMSDFASWVRMYRSTTTPGVSLKFTPQLFENLTGYPANRFSADFCHDCAFLFDVTGFSDHRDASRMLMSNLLHETGRFRWLKEIASGDAYENRQDLQNTEPGDGRRFKGAGVLMLTGRYNFTKLYKFLKETEGVDDPKILTVGCNHVAERYPFTSAISWIKDNNLLDVCLSEGFDSCCYRVNGGWNGYQDRLEMLDRCIKFMV
Physico‐chemical
properties
protein length:244 AA
molecular weight:28136,5 Da
isoelectric point:5,28
hydropathy:-0,40
Representative Protein Details
Accession
1fKSs
Protein name
1fKSs
Sequence length
184 AA
Molecular weight
20638,93040 Da
Isoelectric point
5,38654
Sequence
MSRFSGHPASSFDAQFCNDFNKLLKQTGFNTDLTAFRMLLAQMAHESGNWLYMKECGSTAYFTAMYEGRSDLGNTQPGDGARFSGCGPIQCTGRANFSDSYKYLQQMEGLDDPRFMSEGTPYVGEVYPFQVCIGWLIKNNYFELCKTGDLGSCTKRLNGGTNGLEDRLYWYNKAKQVITEADLS
Other Proteins in cluster: phalp2_5007
Total (incl. this protein): 166 Avg length: 233,9 Avg pI: 5,55

Protein ID Length (AA) pI
1fKSs 184 5,38654
11Qp6 241 5,29679
1A2iA 249 5,18306
1A3ML 252 7,50402
1A8zu 265 5,45048
1AbvP 243 5,80584
1B8J5 228 6,94921
1C8d 228 5,15663
1D2Gf 235 5,66193
1SKuU 265 4,95132
1SzQ7 242 5,34590
1TM5k 276 5,90713
1V8es 247 5,60793
1V9Ze 243 5,14787
1VNL1 236 5,97357
1VSd8 244 5,48322
1Vu1l 246 5,89298
1fKWP 245 5,21085
1ftrB 245 5,31492
1gh1y 192 6,23901
1s7DB 233 5,05312
1sewI 221 4,83821
1toGj 131 5,67829
1uC74 227 5,27849
1uZnh 239 4,55709
1xv9 243 5,58281
1yVL5 239 4,61501
214xz 239 4,91483
25Bj1 245 6,04917
2OE7v 228 5,04312
2XhN2 245 5,95988
2s4CM 239 4,80985
2s548 239 4,83185
2s5f3 228 6,94279
2s7HW 226 5,39052
2s7bs 243 4,80525
2tZCg 228 5,06603
2vXvh 239 4,51867
2vYOU 241 5,22529
2vey1 228 5,26206
2x6PU 235 5,88564
2xbBm 211 4,87266
2zPEk 244 5,76162
37sZr 238 6,70128
3CpI2 227 5,43298
3GuOI 226 5,26860
3HMx6 227 4,90096
3Jhlm 239 6,06764
3Xsh6 243 5,63640
3Z2gN 228 7,56444
3aRT4 242 5,34590
3aY9P 227 5,63856
3hEdU 228 5,39990
3hz3f 235 4,99742
42E3m 243 5,71962
438MT 228 5,56717
43dSU 235 5,10297
47E4y 189 9,31731
4Q9Qd 243 5,36142
4S5f2 239 5,18220
4S62B 235 4,94905
4S799 242 5,77975
4Sd2o 244 5,47930
4Sibd 244 5,57854
4WTaE 235 5,29259
4sRPh 235 6,15512
4sw6H 235 6,37423
4x3mg 222 4,39140
4x8y0 244 4,91660
6BeIU 238 5,23597
6BeJS 227 5,74184
6BkRL 239 4,72840
6BlNb 238 5,08069
6CekD 239 4,62876
6CpvP 238 5,41075
6NooU 228 4,91495
6O1hh 239 5,06193
6OIkh 232 4,68873
6OMND 239 4,89795
6OyHg 252 4,71743
6TzNz 239 4,87544
6X2Yt 235 5,18897
6X4P7 230 5,04715
6X4np 236 4,80513
7CKWn 236 4,58653
7Cnkx 216 5,27855
7Cu0m 237 5,04681
7Cw5n 237 5,19727
7DajR 239 4,90744
7Dtms 226 6,30642
7GYKZ 227 6,11124
7SJme 232 5,15322
7SVNq 227 5,55950
7SWGH 226 8,48883
7UQlz 239 4,57539
7VgHn 243 5,01748
7XAFy 235 5,84262
7YGPl 227 5,42599
7ZF0V 226 5,26081
7rBy0 226 7,53164
80vGW 228 6,98775
80wD0 226 5,82880
816tS 239 4,79047
81aRR 233 4,85493
81vuE 235 6,30733
82Kf9 267 5,44202
85zeQ 227 5,74002
87FwT 232 5,34681
8A0IA 239 4,82940
8BqdK 235 5,50397
8D1QR 238 5,13457
8EBXG 235 5,08200
8ELBf 164 5,16305
8Fnuc 239 4,79007
8GMzj 230 5,13247
8HmLb 227 9,01998
8HmLc 225 6,22804
8Lx7N 244 4,60881
8acba 235 5,08200
8bFZh 226 5,63345
8bdcy 227 5,23126
8beh4 234 5,59054
8bgUs 242 5,59872
8bi7R 236 4,52111
8cKER 236 6,43914
8cUyl 244 5,59662
8cWJU 257 5,26451
8chMA 245 5,09325
8cp7x 227 5,59866
8eDZl 227 5,76895
8edRn 227 6,09811
8f7BU 202 6,51417
8gFh6 226 5,55404
8gxQo 227 6,22509
8hwCl 228 5,28122
8kKdI 227 5,40876
8kN7c 236 6,52758
8kt3c 227 5,31242
8lPpb 244 5,20011
8pqxg 244 4,84401
8q2bW 227 5,96675
8r1qf 226 5,96408
8t03H 244 5,18482
8tX5n 239 4,99168
8tXS9 235 5,09518
8tYWV 221 4,60836
8uF43 233 4,79468
8x8Le 223 4,27869
8xhqV 235 5,08114
8zuwT 226 8,48883
GU2x 245 5,63680
Hg5I 240 6,22787
TLcZ 238 7,57700
YBlu 239 4,83981
fRZr 227 6,42834
gINU 222 8,50907
gKan 241 7,51306
iAEh 228 5,15208
iqfi 235 5,08200
ixPn 235 7,63742
rt3f 239 5,42979
tOPV 243 4,83964
v3Fw 235 5,22535
vEVd 235 5,50397
xWB9 263 5,21256
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_20536
4lbpW
253 39,4% 185 2.948E-56
2 phalp2_6162
5EIXo
59 39,2% 168 1.907E-42
3 phalp2_10052
7rxm7
6 32,9% 185 2.612E-42
4 phalp2_37035
K2lc
7 32,9% 197 5.525E-37
5 phalp2_1654
8rD3A
4011 42,8% 140 2.662E-33
6 phalp2_8404
IwNf
80 37,0% 154 4.446E-29
7 phalp2_23279
520Od
3 30,5% 154 6.082E-29
8 phalp2_12573
1gDri
1 41,8% 148 6.082E-29
9 phalp2_34955
4E7ip
9 40,0% 140 1.557E-28
10 phalp2_17227
3zUSo
139 39,7% 151 1.557E-28

Domains

Domains
Unannotated
Representative sequence (used for alignment): 1fKSs (184 AA)
Member sequence: dV4c (244 AA)
1 184 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1fKSs) rather than this protein.
PDB ID
1fKSs
Method AlphaFoldv2
Resolution 97.77
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50