Protein
- Protein accession
- Y4VB [EnVhog]
- Representative
- 7YsQE
- Source
- EnVhog (cluster: phalp2_26552)
- Protein name
- Y4VB
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 96% (predicted by ML model) - Protein sequence
-
MLILLSYVKENQAAFGAKVSQVASSLGIDPNELMIVMYKESKLNHRAVNSQSGATGLIQFMPSTARSLGTTTEALAAMSNVEQLDYVELYLRPYKSKMKRLIYIYLAVFYPAAIGKASNYVIAKSGSTIYNQNAGLDINRNGVITISDIEGWLISQLPKEAQNYESKKKAIG
- Physico‐chemical
properties -
protein length: 172 AA molecular weight: 18907,6 Da isoelectric point: 9,30 hydropathy: -0,05
Representative Protein Details
- Accession
- 7YsQE
- Protein name
- 7YsQE
- Sequence length
- 162 AA
- Molecular weight
- 18938,89240 Da
- Isoelectric point
- 9,33916
- Sequence
-
MNFIEYVKENKKEFALKVADICNQLNIKPDWLMFVMWFESRLNPQAVNPISGSTGLIQFMPSTARGLGTTTDVLKRMSNVQQLDYVLAYLRPYKDRMKRWIDVYLAVFYPKAMGNPNFVITSDIAAKQNKIFDLNKDLDISVKEIETALRKQIPEKYRKDYL
Other Proteins in cluster: phalp2_26552
| Total (incl. this protein): 123 | Avg length: 176,8 | Avg pI: 8,62 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7YsQE | 162 | 9,33916 |
| 1035j | 170 | 9,30029 |
| 11CrC | 163 | 8,90542 |
| 13d3V | 188 | 9,27940 |
| 148Dz | 163 | 9,27960 |
| 1NJqz | 214 | 4,66986 |
| 1f7W2 | 173 | 9,25574 |
| 1gN2Q | 187 | 9,06698 |
| 1hmlH | 164 | 7,83692 |
| 1lcQU | 164 | 8,50249 |
| 1lztL | 178 | 7,73246 |
| 1miGd | 165 | 6,33598 |
| 1uLrC | 216 | 5,65221 |
| 1yiev | 205 | 9,73216 |
| 20COD | 164 | 9,37733 |
| 27FTR | 205 | 9,63733 |
| 29rpX | 165 | 7,81313 |
| 2Gvbg | 169 | 9,54340 |
| 2HzW0 | 163 | 9,13519 |
| 2KMOf | 163 | 9,39706 |
| 2LXBj | 163 | 9,15504 |
| 2axVd | 205 | 9,66312 |
| 2n3zh | 164 | 6,51110 |
| 2suOe | 172 | 9,20391 |
| 31Lh9 | 205 | 9,66028 |
| 39vXg | 182 | 6,24555 |
| 3RY7W | 171 | 8,70357 |
| 3SPQW | 188 | 9,11572 |
| 3Xnl6 | 202 | 9,33974 |
| 3Y90V | 176 | 7,80024 |
| 3d0Dj | 163 | 9,39680 |
| 3dmzm | 163 | 9,13493 |
| 3f9w4 | 163 | 9,27914 |
| 3lkkh | 163 | 8,55594 |
| 3nhMf | 164 | 8,96654 |
| 3t8dC | 162 | 8,54072 |
| 3tITX | 151 | 7,77826 |
| 3tg45 | 163 | 8,88698 |
| 3vCU2 | 163 | 8,54072 |
| 3vZZB | 163 | 8,78325 |
| 3vuS9 | 165 | 8,92586 |
| 3wOpH | 130 | 8,76752 |
| 3wVAK | 164 | 8,85236 |
| 3xRz6 | 162 | 8,68662 |
| 3xSTY | 162 | 5,55728 |
| 3yonJ | 165 | 5,88371 |
| 4Cb3K | 165 | 8,84850 |
| 4GV68 | 215 | 5,97551 |
| 4HLIM | 204 | 9,42942 |
| 4Igng | 205 | 9,11469 |
| 4SDdm | 162 | 6,35383 |
| 4SFTl | 162 | 9,15466 |
| 4SNVm | 162 | 8,70602 |
| 4SsTJ | 163 | 8,98046 |
| 4StKX | 162 | 8,64826 |
| 4SuQX | 162 | 7,82126 |
| 4UWm8 | 163 | 8,92289 |
| 4VyKF | 163 | 8,54072 |
| 4Zexy | 212 | 7,69511 |
| 4aoKE | 212 | 7,78825 |
| 4f3FT | 205 | 9,58427 |
| 4ucQG | 174 | 9,52013 |
| 4uduk | 163 | 8,98046 |
| 4ukBl | 163 | 9,05944 |
| 5Bp6X | 181 | 7,87966 |
| 5EIlE | 175 | 8,69106 |
| 5ljDb | 206 | 9,64494 |
| 5sQDq | 188 | 8,30283 |
| 5sQDr | 169 | 9,19385 |
| 5sQLy | 206 | 8,89846 |
| 5ujYd | 163 | 8,96022 |
| 5ylJ7 | 205 | 9,76459 |
| 6MPkz | 170 | 7,70006 |
| 6NuS6 | 186 | 9,19250 |
| 6PGcb | 179 | 9,54159 |
| 6UNKD | 163 | 8,79196 |
| 6WrPQ | 170 | 9,01843 |
| 6ZfjF | 163 | 8,86958 |
| 6iaR9 | 168 | 8,91238 |
| 6xtn4 | 216 | 9,58498 |
| 70gbE | 163 | 8,86958 |
| 71ytm | 186 | 8,51577 |
| 72fvg | 179 | 9,79528 |
| 7BbaT | 179 | 9,29958 |
| 7JJd0 | 162 | 8,78235 |
| 7MrT | 194 | 9,58769 |
| 7UIih | 163 | 9,13519 |
| 7UL75 | 168 | 8,89736 |
| 7UmEj | 163 | 9,15504 |
| 7V0p6 | 172 | 6,57448 |
| 7XiHO | 179 | 9,92151 |
| 7ZJfd | 194 | 4,32081 |
| 7ojoL | 179 | 9,49279 |
| 7r2cU | 165 | 8,54756 |
| 7rKgo | 162 | 9,15453 |
| 80t4u | 205 | 9,69748 |
| 81LZs | 187 | 9,30048 |
| 82QWr | 200 | 9,75060 |
| 86Pa3 | 162 | 9,19592 |
| 88vHy | 214 | 9,82197 |
| 8YAh | 162 | 9,29965 |
| 8bP8l | 170 | 9,12764 |
| 8eoRI | 165 | 6,33598 |
| 8g8BS | 196 | 9,47629 |
| 8nhRx | 175 | 9,00193 |
| 8nhXv | 215 | 9,28656 |
| 8njz3 | 200 | 7,70711 |
| 8qV4u | 165 | 6,33598 |
| 8rjK0 | 173 | 8,35738 |
| 8rxJt | 163 | 9,05963 |
| CHf9 | 185 | 8,84759 |
| GYXw | 205 | 9,71585 |
| ItzH | 177 | 9,02295 |
| KgXh | 205 | 9,60123 |
| Nn2W | 165 | 8,56387 |
| ZvYL | 162 | 9,15453 |
| caYv | 164 | 5,79953 |
| etGl | 164 | 9,06053 |
| fk4q | 194 | 5,45310 |
| oRyi | 168 | 8,90155 |
| qLZi | 179 | 9,77420 |
| A0A345MR89 | 192 | 9,28379 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_34411
4p3Yl
|
41 | 38,2% | 175 | 7.199E-59 |
| 2 |
phalp2_38137
6S6gW
|
387 | 42,9% | 149 | 1.585E-53 |
| 3 |
phalp2_31418
3cbTJ
|
6 | 44,6% | 141 | 1.193E-50 |
| 4 |
phalp2_27366
4D2kq
|
9 | 45,0% | 140 | 2.373E-44 |
| 5 |
phalp2_11161
5ECat
|
11 | 42,2% | 161 | 6.111E-44 |
| 6 |
phalp2_33581
8LkMh
|
2 | 35,6% | 146 | 4.050E-43 |
| 7 |
phalp2_2622
6NuZv
|
5 | 37,5% | 165 | 1.429E-42 |
| 8 |
phalp2_27181
3ezVK
|
6 | 36,7% | 155 | 9.466E-42 |
| 9 |
phalp2_14771
6U5Ok
|
8 | 43,9% | 141 | 3.339E-41 |
| 10 |
phalp2_6745
2advY
|
3 | 39,8% | 158 | 8.594E-41 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(7YsQE)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50