Protein

Protein accession
1Lh5N [EnVhog]
Representative
3OKnd
Source
EnVhog (cluster: phalp2_20469)
Protein name
1Lh5N
Lysin probability
97%
PhaLP type
endolysin
Probability: 53% (predicted by ML model)
Protein sequence
MRAEDIVAAARSALGIPFRHQGRSSRGLDCVGLLLYVADRIGVEYVDVSGYSRRPSGGLLEETFENHVDRGVLLRIDPKEMQSGDFLMMKFTGDPQHLAILSGDNIIHSHLRVGKVCEHRLDDMWRDRIVRVYRIAGVTE
Physico‐chemical
properties
protein length:140 AA
molecular weight:15774,9 Da
isoelectric point:6,59
hydropathy:-0,21
Representative Protein Details
Accession
3OKnd
Protein name
3OKnd
Sequence length
165 AA
Molecular weight
18104,32130 Da
Isoelectric point
6,82894
Sequence
MKKLTAQLTPQLTAQQVISAARQYVGLKYRTQGRDVVGESAGLDCGGLLVVVCKELSITDSDLSGYSNSPDGATFEKLLQTDLDEVTPKEDVRLADILAMNYGEGVQHIAIVSAINKEANRYTVIHAKRPRGSFGSTDKGVIEQYLHGYDLRAWSKTFRIKGIEN
Other Proteins in cluster: phalp2_20469
Total (incl. this protein): 174 Avg length: 138,8 Avg pI: 7,33

Protein ID Length (AA) pI
3OKnd 165 6,82894
11al1 141 6,50979
14CK6 135 6,88681
14CeL 135 5,90213
14G1g 137 6,49797
16ZMq 136 6,95319
16ZyV 139 7,01691
1907S 137 6,38958
1AEn0 136 8,80182
1BNhf 138 9,27773
1CpYP 140 9,77549
1Fvkq 155 5,72831
1KUCp 136 6,75528
1L4k3 137 5,78362
1La5G 138 7,06573
1LkPg 141 6,96229
1M9sL 137 6,99412
1MfEH 138 7,05789
1R0U3 138 6,35167
1SGSl 141 8,37124
1XHUm 136 7,17003
1XNGG 138 6,17376
1Xh0p 136 6,64314
1XiWE 137 5,08944
1Xk7h 137 5,73269
1XnO5 137 5,14048
1XqaP 135 8,79080
1YdHt 138 6,26953
1Z6L9 136 6,18058
1a0iW 142 7,84749
1gmEr 164 8,39967
1jYSk 154 9,12571
1jmhY 129 5,92407
1l7Mg 135 6,58368
1ozLc 137 5,68892
20C3W 138 6,27664
25dcm 149 6,18706
29mLL 134 9,27534
2HAlh 137 5,58093
2LnWm 141 7,78831
2Px1l 140 7,70114
2Q480 138 5,90235
2QXh3 133 9,07252
2S5YP 140 7,01287
2cJJ8 141 8,53924
2ckWS 142 9,66550
35cn9 140 7,65493
36BAu 137 6,56970
36CVx 138 8,62788
36x8o 137 6,49183
36zMV 137 7,01310
39YDR 137 8,49018
3Qqgo 164 7,07551
3R9On 137 6,16251
3TWMc 144 6,58562
3VpUQ 133 9,32575
3ZpLm 143 7,75843
3bGkF 139 8,29355
3eoT3 139 8,88885
3g7GJ 137 7,01555
3mD09 139 8,38168
3nnav 135 6,05355
3zAuQ 140 5,17453
40VE2 133 7,87747
452gp 143 7,09972
46Jw4 128 6,39316
47Sho 133 9,02997
47UDF 135 5,77782
49Tp4 128 7,99783
4FOyn 150 8,71021
4GM0S 152 7,02362
4IQuQ 138 7,00998
4LHPm 136 7,97147
4LIC7 137 8,66263
4LQlS 136 6,58755
4MDL9 133 8,73922
4Mo4D 136 9,22950
4Nb3W 136 6,99662
4QiG1 138 6,23066
4QjU7 123 6,39032
4Qn2U 135 6,69475
4QrN3 136 6,13846
4YxyR 138 7,17725
4ZUBI 142 7,12570
4dEdR 144 6,28966
4eN5Y 137 5,37352
4f5rk 138 6,49092
4fXCw 146 6,12556
4fdW1 136 6,64160
4fo26 137 7,80682
4gzps 137 5,80868
4kV8D 139 8,40934
4m3s9 111 5,70427
4qSLv 158 6,74380
4sL3g 140 6,51121
4tsHr 140 6,95825
4ubof 144 6,69634
4wzzM 137 6,05258
4xs7z 136 7,79347
51hgi 111 5,92100
51yQg 111 5,91395
51zZD 111 6,12471
5Bu2c 145 6,49973
5I8B4 140 8,70589
5IGzf 160 5,85603
5JovA 141 6,98946
5f4WT 111 6,12965
5fdiE 111 6,37736
5liKX 158 5,71592
5sKSv 135 8,68030
5xaNZ 143 7,89842
6E1kt 135 9,35154
6MiCb 177 9,01727
6PEiu 137 9,12165
6Qtdl 136 6,96070
6RkzJ 138 7,01299
6SMQe 149 6,28238
6SSJo 136 6,96331
6Sqh9 138 8,76121
6VgIy 133 6,58158
6W5LO 138 6,70390
6WWki 167 10,55465
6XBPb 137 6,49155
721Sm 141 9,03043
75O37 138 6,33621
7Cs0O 136 8,50920
7L07v 138 8,57386
7V8oM 137 9,01121
7XXmD 137 9,44167
7deRb 140 8,52557
7eiKO 139 7,77710
7f9fG 143 6,11925
7gBrh 139 6,14415
808be 138 4,99935
80zci 137 6,27721
81plG 137 9,32363
85PBX 145 9,23743
867Dz 142 5,75162
8A3lJ 145 9,35792
8COfr 145 9,31834
8CPPz 145 8,69326
8CngT 145 9,23743
8CozZ 145 9,21906
8FneN 128 9,46565
8a75o 137 6,06918
8aD7u 139 4,95621
8eITB 137 8,85817
8eJEr 138 5,91105
8fLe9 138 7,03385
8ix2i 137 6,89476
8n3po 134 9,36579
8pPqT 137 8,46594
8rePD 137 6,17376
8yOCe 141 9,12287
95xu 141 6,74107
991J 139 6,73925
AOae 135 7,72433
ASNF 133 9,09605
ZXTX 149 7,65743
Zw4S 138 6,49092
cZDq 137 8,98543
dgeQ 148 8,52912
e73p 152 8,69119
e9lS 136 8,49456
hBzP 140 8,00389
i9hf 137 9,05164
jaWn 139 4,99628
jkhE 140 5,77680
l9iE 137 7,77185
mbtJ 133 7,83570
qEdt 138 6,49035
rFB 137 7,76804
w7Hp 145 9,13261
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_38771
1fCGD
1216 33,9% 153 8.237E-59
2 phalp2_28766
4PrSU
248 28,6% 150 2.510E-40
3 phalp2_36512
1oWEW
304 26,5% 128 8.183E-36
4 phalp2_922
7oz39
3811 24,6% 158 1.259E-33
5 phalp2_19724
4MrB2
69 28,1% 160 1.139E-32
6 phalp2_29511
1Z7BX
61 25,9% 162 4.008E-32
7 phalp2_33260
5BBWg
36 27,5% 160 2.390E-30
8 phalp2_201
5IaYc
48 32,2% 118 4.508E-27
9 phalp2_18529
6TZ8D
34 21,2% 146 4.508E-27
10 phalp2_14018
8dxHF
12 23,8% 151 6.171E-27

Domains

Domains
Unannotated
Representative sequence (used for alignment): 3OKnd (165 AA)
Member sequence: 1Lh5N (140 AA)
1 165 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3OKnd) rather than this protein.
PDB ID
3OKnd
Method AlphaFoldv2
Resolution 86.28
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50