Protein
- Protein accession
- UoMx [EnVhog]
- Representative
- 1ZwF3
- Source
- EnVhog (cluster: phalp2_4186)
- Protein name
- UoMx
- Lysin probability
- 90%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MQPVQAATQADYLKLYAHSRIIDWKQYHCFVKIIYKESRWDPKARNGSHFGLGQMRSQWYRNLDPYRQIDQTIKYITIRYQTPCKAWAFHERKGWF
- Physico‐chemical
properties -
protein length: 96 AA molecular weight: 11773,4 Da isoelectric point: 9,80 hydropathy: -0,83
Representative Protein Details
- Accession
- 1ZwF3
- Protein name
- 1ZwF3
- Sequence length
- 77 AA
- Molecular weight
- 8859,05470 Da
- Isoelectric point
- 7,93427
- Sequence
-
MRRTLLILGITLALLAAPQASASKDWKDHPMNYKLHAYNLLLDFEEFQCIVELYEKESNWRPSARNGSHFGIPQGRS
Other Proteins in cluster: phalp2_4186
| Total (incl. this protein): 162 | Avg length: 117,7 | Avg pI: 9,61 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1ZwF3 | 77 | 7,93427 |
| 12Wx8 | 161 | 10,08313 |
| 18L3p | 132 | 9,73777 |
| 18Q6T | 105 | 9,54340 |
| 19HBm | 122 | 10,18022 |
| 19O1Y | 105 | 9,51671 |
| 1JNZR | 110 | 10,18035 |
| 1KaHi | 161 | 9,76704 |
| 1KaIe | 153 | 9,60284 |
| 1Kfvf | 60 | 9,51703 |
| 1Mufl | 151 | 8,32875 |
| 1dZAB | 96 | 10,01260 |
| 1h2J4 | 110 | 9,72726 |
| 1h43l | 112 | 9,61612 |
| 1jzRU | 113 | 9,54211 |
| 1snn2 | 89 | 9,78109 |
| 1tKTn | 142 | 9,86897 |
| 1yicm | 135 | 9,27650 |
| 1z8vp | 106 | 9,95729 |
| 25OyR | 75 | 9,86664 |
| 2Y0K6 | 127 | 9,75092 |
| 2j8jm | 174 | 9,15098 |
| 2j91F | 138 | 9,27985 |
| 2jb58 | 149 | 9,86742 |
| 2jenI | 142 | 9,47732 |
| 31o2S | 120 | 9,82448 |
| 321mo | 70 | 9,66338 |
| 32POy | 115 | 9,72933 |
| 32V9p | 131 | 9,86400 |
| 32YeS | 174 | 9,37739 |
| 32crH | 174 | 9,26806 |
| 38ccE | 188 | 10,43016 |
| 38m0Y | 152 | 9,75389 |
| 3VVWE | 164 | 9,91055 |
| 3bmoC | 81 | 9,71927 |
| 44Ipn | 84 | 10,01969 |
| 46NS1 | 132 | 9,96780 |
| 48M8K | 155 | 9,50846 |
| 48fGs | 153 | 9,45334 |
| 48fwt | 135 | 10,05541 |
| 499ke | 178 | 10,00867 |
| 4CdX0 | 159 | 9,97489 |
| 4NAAX | 72 | 9,41549 |
| 4NwYA | 96 | 9,69548 |
| 4O5zE | 109 | 8,52332 |
| 4QTbB | 97 | 9,46836 |
| 4a6Qy | 153 | 9,48680 |
| 4bOmy | 154 | 9,84988 |
| 4h7G7 | 96 | 9,77632 |
| 4m7Bx | 96 | 9,89495 |
| 4md56 | 112 | 9,62650 |
| 4mdK8 | 96 | 9,94974 |
| 4mocj | 110 | 9,75789 |
| 4n71V | 112 | 9,56764 |
| 4nFB4 | 128 | 9,48744 |
| 4naX1 | 96 | 9,56880 |
| 4oVcx | 112 | 9,48815 |
| 4pmgT | 112 | 9,54527 |
| 4poqu | 96 | 9,84730 |
| 4rAsw | 178 | 9,91835 |
| 4rQE8 | 95 | 9,69632 |
| 4rSn8 | 90 | 6,89209 |
| 4rVmF | 110 | 9,81094 |
| 4sb8U | 112 | 9,59620 |
| 4wp32 | 109 | 9,67092 |
| 501LJ | 126 | 10,42011 |
| 50tEH | 96 | 10,07385 |
| 518A5 | 110 | 9,81094 |
| 52ERw | 110 | 9,58672 |
| 535xw | 105 | 9,35090 |
| 53CrL | 112 | 9,48776 |
| 54oda | 112 | 9,59620 |
| 56Egr | 112 | 9,46256 |
| 56xc9 | 112 | 9,51549 |
| 56yLS | 112 | 9,54172 |
| 56yQw | 109 | 9,86948 |
| 58LNK | 97 | 9,75814 |
| 58NwN | 95 | 9,89804 |
| 598Dn | 71 | 9,56493 |
| 59ZNJ | 96 | 9,66022 |
| 5AZXc | 104 | 9,72900 |
| 5aav8 | 121 | 9,73197 |
| 5acbK | 112 | 9,69593 |
| 5ccq3 | 112 | 9,62650 |
| 5d1fe | 128 | 9,66441 |
| 5eFBl | 109 | 9,63830 |
| 5eWAg | 165 | 10,04161 |
| 5eelS | 96 | 9,69393 |
| 5erk0 | 159 | 10,02105 |
| 5fT48 | 112 | 9,48822 |
| 5fnTV | 96 | 9,94974 |
| 5fsMw | 96 | 9,65977 |
| 5g6oP | 112 | 9,69497 |
| 5gMtb | 112 | 9,48847 |
| 5gn4Y | 96 | 10,01092 |
| 5iHqo | 92 | 9,42697 |
| 5iRGP | 159 | 10,25107 |
| 5iasL | 112 | 9,48783 |
| 5icjh | 109 | 6,89005 |
| 5jfbQ | 64 | 8,93450 |
| 5kNrV | 110 | 9,69832 |
| 5kPXe | 103 | 9,59001 |
| 5l5Rq | 93 | 9,78303 |
| 5l7EJ | 117 | 9,48157 |
| 5mTnQ | 112 | 9,69497 |
| 5n1cV | 58 | 7,92924 |
| 5nwFo | 158 | 10,02001 |
| 5o2qO | 112 | 9,51587 |
| 5tsLv | 152 | 9,40763 |
| 5ulW0 | 97 | 9,69484 |
| 5vMlt | 126 | 10,42011 |
| 5vPDP | 96 | 9,82519 |
| 5vrry | 112 | 9,51549 |
| 5vxqK | 66 | 9,41607 |
| 5w4g2 | 107 | 7,92660 |
| 5wPRK | 161 | 9,85568 |
| 5wXVr | 112 | 9,48776 |
| 5wYI1 | 179 | 9,90571 |
| 5wtJo | 153 | 9,59233 |
| 5x3bC | 112 | 9,48815 |
| 5xSYM | 121 | 9,72746 |
| 5y4Bf | 112 | 9,48815 |
| 5y6hl | 112 | 9,62650 |
| 5z7Li | 112 | 9,46256 |
| 5zfvv | 96 | 10,01092 |
| 6Ay3p | 104 | 9,54572 |
| 6AzZj | 111 | 9,71050 |
| 6Gmi2 | 97 | 9,73197 |
| 6IFD7 | 112 | 9,54566 |
| 6Isyl | 95 | 9,82487 |
| 6KS2t | 96 | 9,41588 |
| 6MLIY | 95 | 9,72507 |
| 6Mrbk | 100 | 9,30074 |
| 6xOFB | 80 | 9,33504 |
| 6xutW | 109 | 9,72352 |
| 6yI5c | 166 | 10,04909 |
| 6yaZU | 151 | 8,95751 |
| 6z0ju | 96 | 10,06463 |
| 6zaZV | 169 | 9,91048 |
| 87cqO | 150 | 9,93369 |
| 88sKa | 106 | 9,54372 |
| 8FXwO | 115 | 9,51626 |
| 8mwal | 96 | 9,89591 |
| 8oSST | 138 | 9,84066 |
| BURE | 115 | 9,41936 |
| C8WB | 122 | 9,75640 |
| C8Wb | 155 | 9,69303 |
| G0Sl | 112 | 9,51587 |
| IHfW | 112 | 9,62605 |
| LmVS | 95 | 9,80888 |
| S1vJ | 120 | 9,28056 |
| SOmw | 110 | 9,75112 |
| SPtA | 179 | 9,28437 |
| Stdl | 98 | 9,69729 |
| Sx6W | 95 | 9,56880 |
| T9Lh | 115 | 9,69671 |
| TCwr | 174 | 9,37739 |
| UdCU | 153 | 9,53283 |
| UyoG | 96 | 9,94858 |
| t4VT | 155 | 9,66602 |
| t5J2 | 105 | 9,46410 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_2408
4Yeka
|
404 | 43,6% | 71 | 7.513E-18 |
| 2 |
phalp2_34185
2JiXO
|
11 | 41,7% | 67 | 1.120E-14 |
| 3 |
phalp2_18298
57J38
|
2 | 39,3% | 66 | 2.143E-10 |
| 4 |
phalp2_2439
5hDKy
|
5 | 41,3% | 58 | 5.568E-10 |
| 5 |
phalp2_30553
5CWOA
|
1 | 43,2% | 67 | 1.989E-09 |
| 6 |
phalp2_34644
5wXUO
|
3 | 28,1% | 64 | 4.802E-08 |
| 7 |
phalp2_14710
6zGSB
|
2 | 27,6% | 47 | 8.442E-07 |
| 8 |
phalp2_11122
5nuC5
|
3 | 35,3% | 65 | 1.161E-06 |
| 9 |
phalp2_5567
3Wp4H
|
119 | 28,1% | 71 | 2.810E-05 |
| 10 |
phalp2_17642
6LXup
|
5 | 36,3% | 66 | 7.311E-05 |
Domains
Domains
1
77 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1ZwF3)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50