Protein
- Protein accession
- T1WL [EnVhog]
- Representative
- 5eP1K
- Source
- EnVhog (cluster: phalp2_16312)
- Protein name
- T1WL
- Lysin probability
- 93%
- PhaLP type
-
endolysin
Probability: 89% (predicted by ML model) - Protein sequence
-
MNSYPHTYPQAPVDDATLRNQSLTDCQDSSLYLKDNILKIKINKKKINIKLKTNKNLLAIPMSILILTVSTTVEAKAVSQTDLLKLYAHSRLVSMEQFTCLDRLITKESNWRVDARNGSHYGLGQMKNVKYGRLDGFSMVDWSIRYITKRYGSMCNAWRFFKANGYH
- Physico‐chemical
properties -
protein length: 167 AA molecular weight: 19245,1 Da isoelectric point: 9,71 hydropathy: -0,41
Representative Protein Details
- Accession
- 5eP1K
- Protein name
- 5eP1K
- Sequence length
- 193 AA
- Molecular weight
- 22304,12400 Da
- Isoelectric point
- 9,62527
- Sequence
-
MHEMRSHGRGIGRVKVMRGYTQALHTGVDNPLDTPKNEREVDIDLHGGCTLDAYNTQSLSHLISENESFSYLSKIKKMINKKTNWLMLIGSLIAMQGVDSAHAANSTDSLRLYAHSRLVNFEQFLCFNKIITKESNWRVNAKNGSHYGLGQMKSKWYRNLDGFRQIDQTIKYISVRYSTPCKAWSFHQRNNWF
Other Proteins in cluster: phalp2_16312
| Total (incl. this protein): 178 | Avg length: 170,2 | Avg pI: 9,80 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 5eP1K | 193 | 9,62527 |
| 12XUm | 137 | 9,67620 |
| 17R4J | 161 | 9,70947 |
| 18rG9 | 174 | 9,92376 |
| 19Gq8 | 134 | 9,74770 |
| 19H9Q | 199 | 9,72346 |
| 19PqC | 135 | 10,08481 |
| 1JBVI | 163 | 9,70825 |
| 1JE6n | 139 | 9,65364 |
| 1Mkzl | 174 | 9,97199 |
| 1aDH3 | 134 | 9,79483 |
| 1aDMo | 169 | 9,75918 |
| 1aQBZ | 174 | 9,64287 |
| 1aYVH | 174 | 9,61328 |
| 1ayek | 175 | 9,76975 |
| 1cL3f | 174 | 9,91938 |
| 1sn58 | 199 | 9,60110 |
| 1snZM | 170 | 9,84621 |
| 1xWmx | 154 | 9,79882 |
| 1ycdd | 163 | 9,70741 |
| 25M6d | 154 | 9,79470 |
| 280DL | 175 | 9,91319 |
| 2GAw8 | 192 | 9,81958 |
| 2VVMg | 175 | 9,91886 |
| 2Ytc6 | 170 | 9,84621 |
| 2j6Zo | 174 | 9,80508 |
| 2j74f | 175 | 9,68343 |
| 2jmR5 | 134 | 9,83744 |
| 2jmm0 | 172 | 9,82803 |
| 3075f | 175 | 9,78554 |
| 30MZC | 174 | 9,70831 |
| 30OvJ | 170 | 9,46810 |
| 30fnp | 162 | 9,60645 |
| 30qmJ | 174 | 9,63514 |
| 31nVL | 162 | 9,59233 |
| 31oEW | 168 | 9,70663 |
| 31qy1 | 168 | 9,58672 |
| 31xZn | 174 | 9,77832 |
| 320J1 | 171 | 9,76350 |
| 3292b | 167 | 9,64558 |
| 32Rsm | 174 | 9,68646 |
| 32Ymw | 167 | 9,75956 |
| 33YwF | 176 | 9,78451 |
| 33zCr | 174 | 9,85169 |
| 363IW | 167 | 9,79412 |
| 37dp7 | 174 | 9,70831 |
| 37dvr | 167 | 9,68536 |
| 37fem | 168 | 9,71811 |
| 37x0X | 165 | 9,71940 |
| 44kvi | 187 | 9,71547 |
| 44qPv | 160 | 9,80417 |
| 45TWI | 178 | 9,81526 |
| 45X79 | 185 | 10,00744 |
| 47B4x | 176 | 9,67479 |
| 49UXM | 178 | 9,79276 |
| 49wzA | 185 | 9,98056 |
| 49xks | 175 | 9,78593 |
| 4Aup8 | 174 | 9,81913 |
| 4D9UW | 174 | 9,58646 |
| 4Gda7 | 174 | 9,51690 |
| 4Genc | 144 | 9,81868 |
| 4GhVW | 173 | 9,76343 |
| 4Gi32 | 191 | 9,78451 |
| 4GiI9 | 191 | 9,80746 |
| 4a5s6 | 174 | 10,13980 |
| 4bKrr | 135 | 10,08481 |
| 4bO51 | 151 | 9,76904 |
| 4ghpW | 140 | 9,39151 |
| 4gi17 | 155 | 9,73397 |
| 4gq3v | 191 | 10,12574 |
| 4h0lT | 134 | 9,74319 |
| 4lsGh | 161 | 9,90610 |
| 4mAqP | 176 | 9,84176 |
| 4n2SU | 175 | 9,80817 |
| 4n9oA | 208 | 10,00777 |
| 4nnzU | 176 | 9,82023 |
| 4pcYE | 174 | 9,57151 |
| 4qMLV | 173 | 9,75937 |
| 4qNHP | 174 | 9,78058 |
| 4qnZM | 176 | 9,95136 |
| 507Te | 167 | 9,75318 |
| 508pz | 175 | 9,76582 |
| 50NO5 | 169 | 9,70670 |
| 50iDs | 185 | 9,95335 |
| 51TTZ | 175 | 9,90552 |
| 51kF9 | 185 | 10,12942 |
| 52Uw4 | 162 | 10,17087 |
| 52dL7 | 135 | 10,08590 |
| 52zAf | 174 | 10,03317 |
| 53W7t | 161 | 9,83422 |
| 53y1e | 174 | 9,72946 |
| 54yKI | 175 | 9,85743 |
| 553BT | 175 | 9,72765 |
| 55Cdi | 169 | 9,64133 |
| 55fFd | 173 | 10,10814 |
| 55j8r | 174 | 9,56796 |
| 56CFB | 140 | 9,81939 |
| 56Dcg | 166 | 9,68639 |
| 56HDK | 174 | 9,69645 |
| 57u5t | 208 | 10,01234 |
| 58N69 | 178 | 9,69555 |
| 58r3E | 174 | 9,75531 |
| 58tTp | 185 | 9,83125 |
| 592FP | 178 | 9,69580 |
| 59mJq | 167 | 9,72662 |
| 5AUpx | 210 | 9,76311 |
| 5C3H9 | 175 | 9,74796 |
| 5CtGy | 174 | 9,75247 |
| 5DLqh | 174 | 9,76614 |
| 5aMRo | 169 | 9,68581 |
| 5b417 | 173 | 10,00306 |
| 5bZgn | 173 | 10,20820 |
| 5d7SE | 174 | 9,69587 |
| 5eU6I | 178 | 9,43961 |
| 5eody | 174 | 9,77690 |
| 5fP7J | 175 | 9,80778 |
| 5fj73 | 175 | 9,80778 |
| 5go33 | 185 | 9,77671 |
| 5gyZe | 178 | 9,83086 |
| 5hDXQ | 174 | 9,70670 |
| 5hOxB | 174 | 9,94414 |
| 5hwhB | 178 | 9,83808 |
| 5iAsT | 174 | 9,56796 |
| 5ih3s | 168 | 9,83164 |
| 5kOGo | 191 | 9,83454 |
| 5l5b5 | 165 | 9,73371 |
| 5nlJA | 168 | 9,75318 |
| 5tlKU | 175 | 9,70702 |
| 5tvt0 | 167 | 9,83164 |
| 5uaHv | 167 | 9,70709 |
| 5vYyO | 178 | 9,73855 |
| 5w9OR | 185 | 9,98108 |
| 5wPQS | 185 | 10,03452 |
| 5wbKB | 185 | 10,05895 |
| 5wtca | 174 | 9,62096 |
| 5x0TY | 128 | 9,82268 |
| 5y2Zk | 166 | 9,79431 |
| 5y4VF | 160 | 9,73255 |
| 5yspE | 175 | 9,74796 |
| 5zimj | 168 | 9,64101 |
| 6Agko | 176 | 10,05586 |
| 6Ggys | 173 | 9,79928 |
| 6IDCS | 174 | 9,76001 |
| 6IsLy | 174 | 9,90378 |
| 6Iyhe | 171 | 9,63514 |
| 6PCiw | 174 | 9,75318 |
| 6Upqd | 185 | 9,89791 |
| 6xCFg | 161 | 9,80553 |
| 6xbxX | 186 | 10,00416 |
| 6yIHT | 167 | 9,68613 |
| 6zmy5 | 176 | 9,68613 |
| 7XKAS | 174 | 9,94420 |
| 7XKHi | 174 | 9,85942 |
| 83FWC | 164 | 9,95838 |
| 87JB0 | 172 | 9,69606 |
| 8mAiB | 186 | 9,94826 |
| 8sdd7 | 170 | 9,65358 |
| 8ssrm | 168 | 9,70741 |
| C7H0 | 135 | 10,01608 |
| C8JU | 170 | 9,68407 |
| C8KC | 165 | 9,97979 |
| C8Nt | 135 | 10,04200 |
| C9M1 | 167 | 9,77871 |
| CfzW | 169 | 9,77084 |
| Q9Zm | 174 | 9,81997 |
| RZTd | 169 | 9,77761 |
| SpLa | 153 | 9,96599 |
| Stiy | 174 | 9,73925 |
| U9yx | 165 | 9,49447 |
| Uc8p | 169 | 9,71772 |
| UcKL | 165 | 9,84015 |
| Uuye | 174 | 9,79431 |
| iOZI | 171 | 10,03555 |
| A0A6J5NRQ8 | 160 | 9,75453 |
| A0A6J5NW93 | 155 | 9,50865 |
| A0A6J5S5Z2 | 155 | 9,93995 |
| A0A6J5T6D7 | 158 | 10,07114 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_24722
6xRGD
|
450 | 34,3% | 157 | 5.048E-30 |
| 2 |
phalp2_39477
5a1kB
|
101 | 30,6% | 137 | 1.460E-22 |
Domains
Domains
1
193 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(5eP1K)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50