Protein
- Protein accession
- RvNn [EnVhog]
- Representative
- 6AJjn
- Source
- EnVhog (cluster: phalp2_9165)
- Protein name
- RvNn
- Lysin probability
- 98%
- PhaLP type
-
endolysin
Probability: 94% (predicted by ML model) - Protein sequence
-
MKHRHLILAFIAIIVPPNFGWQAGEIDHDAIWQAICQVESGGDPSEHNPGEDARGIAQITPIFVRDINRIVGSEKYTHDDAWCAEKSREMFDIYNRHYHPKGDYERIARCWQGGPKGHLRESEVNDKYWAKVRKELER
- Physico‐chemical
properties -
protein length: 138 AA molecular weight: 16035,8 Da isoelectric point: 6,23 hydropathy: -0,76
Representative Protein Details
- Accession
- 6AJjn
- Protein name
- 6AJjn
- Sequence length
- 192 AA
- Molecular weight
- 21677,91040 Da
- Isoelectric point
- 9,67911
- Sequence
-
MKKIENIALAFLCVFMFNALTTSAQSEDSILILKPGSSTKDVLAYTANHSKFSNDVADTQYPVMGIDTVGDDIPDSVAKFNWTPIINGIIQVESKGNPKAVSGLSVGVMQITPVLVSDCNRILRRRKCRKRFSLRDRWSVSKSKEMFLIFQSFYNPLNDLERAIRSWNGGVHYSIKRTQRYFEKVMAAMKAL
Other Proteins in cluster: phalp2_9165
| Total (incl. this protein): 149 | Avg length: 164,4 | Avg pI: 8,13 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 6AJjn | 192 | 9,67911 |
| 1255r | 177 | 9,44618 |
| 14aI9 | 162 | 9,07755 |
| 14bb3 | 143 | 9,45869 |
| 15ULX | 162 | 9,12732 |
| 1P4fr | 170 | 5,65067 |
| 1PAVF | 142 | 9,69426 |
| 1V2Fd | 159 | 9,70908 |
| 1iBH9 | 161 | 6,64626 |
| 1s8DA | 173 | 6,66525 |
| 1t0Lj | 142 | 8,40631 |
| 1tPou | 173 | 6,66525 |
| 1tsUa | 173 | 7,77845 |
| 1ubf7 | 173 | 6,39276 |
| 1xAIv | 172 | 9,49150 |
| 1z4bn | 171 | 10,03755 |
| 28Hte | 140 | 9,09734 |
| 29iZN | 179 | 8,34957 |
| 29mcI | 180 | 6,91346 |
| 2Gbjj | 165 | 5,57041 |
| 2I4bJ | 184 | 6,84435 |
| 2IxgV | 165 | 5,57041 |
| 2JMlh | 162 | 8,81420 |
| 2Jg9Y | 165 | 5,32811 |
| 2N02H | 166 | 6,21372 |
| 2QWJR | 162 | 8,86861 |
| 2YMA3 | 179 | 8,89801 |
| 2nFkr | 170 | 4,93944 |
| 2nG1l | 163 | 8,70402 |
| 2oYzR | 180 | 8,37278 |
| 2vwA3 | 134 | 7,75411 |
| 2wX2U | 145 | 8,78938 |
| 2xien | 171 | 9,81268 |
| 2xisD | 170 | 9,68233 |
| 2yinm | 172 | 9,53779 |
| 35uDb | 160 | 9,19095 |
| 38CM1 | 184 | 6,00319 |
| 39G4s | 173 | 7,79998 |
| 3J3Li | 149 | 9,48570 |
| 3QuC3 | 150 | 9,86387 |
| 3Qv3W | 169 | 9,74686 |
| 3S703 | 147 | 5,97295 |
| 3Xdez | 144 | 9,58079 |
| 3Xocx | 151 | 9,72456 |
| 3Z3KL | 171 | 7,77993 |
| 3hDz6 | 180 | 9,80953 |
| 3mQFm | 151 | 9,70863 |
| 3mTEO | 174 | 6,92563 |
| 4Bt7e | 161 | 9,29874 |
| 4DHyT | 145 | 6,84293 |
| 4JLzv | 162 | 5,61441 |
| 4MdyX | 117 | 9,02881 |
| 4QD7s | 148 | 9,00896 |
| 4Vgvn | 172 | 7,68471 |
| 4hMnI | 172 | 9,27502 |
| 4hXak | 184 | 8,22889 |
| 4imhd | 180 | 6,44744 |
| 4ixnS | 172 | 9,18373 |
| 4jvX7 | 155 | 9,21029 |
| 4tgLf | 162 | 9,51304 |
| 4x9Tw | 174 | 5,83392 |
| 6AZUq | 174 | 6,19712 |
| 6B1Fk | 162 | 8,89665 |
| 6B1rr | 174 | 5,84796 |
| 6B95U | 137 | 4,94098 |
| 6Bcq4 | 172 | 9,61657 |
| 6Bor6 | 172 | 9,61657 |
| 6FXYM | 127 | 9,06337 |
| 6HAkn | 208 | 9,37346 |
| 6JP0Q | 177 | 7,78535 |
| 6NYVa | 196 | 4,89437 |
| 6NfVW | 164 | 5,17260 |
| 6OF9M | 147 | 8,67875 |
| 6QVao | 173 | 8,43854 |
| 6V1JX | 141 | 7,95400 |
| 6X0KY | 157 | 5,64311 |
| 6sK2H | 146 | 9,96941 |
| 6z6N | 193 | 8,97872 |
| 7COpQ | 172 | 4,84566 |
| 7EUzH | 138 | 8,83264 |
| 7Ec8g | 164 | 9,54230 |
| 7Eujc | 169 | 7,06716 |
| 7FzNJ | 172 | 9,95561 |
| 7GCyh | 147 | 9,37785 |
| 7GrVl | 142 | 9,67911 |
| 7HCPr | 178 | 9,40447 |
| 7LuRB | 177 | 8,86951 |
| 7Lzf6 | 205 | 5,29236 |
| 7SENW | 177 | 6,86180 |
| 7SRRP | 158 | 9,86065 |
| 7SXaO | 171 | 8,47671 |
| 7TO3 | 164 | 5,39313 |
| 7TyPO | 173 | 5,26502 |
| 7UuSj | 147 | 9,37785 |
| 7Uy2M | 177 | 8,96834 |
| 7V85w | 171 | 8,47671 |
| 7VH3t | 172 | 9,62450 |
| 7VePv | 164 | 9,46971 |
| 7Xz5a | 142 | 8,98446 |
| 7ZLDP | 164 | 8,66566 |
| 828nF | 164 | 8,89652 |
| 82OhZ | 172 | 9,49150 |
| 83fdi | 157 | 8,33778 |
| 83fy5 | 184 | 7,66533 |
| 85HoI | 173 | 5,26502 |
| 86wS3 | 184 | 5,74065 |
| 87bdi | 140 | 7,73905 |
| 88yOm | 157 | 9,84189 |
| 8AGih | 158 | 9,81849 |
| 8C6xA | 171 | 8,47671 |
| 8CKDw | 174 | 9,07729 |
| 8CoVu | 157 | 8,31792 |
| 8Cqpt | 161 | 10,04155 |
| 8Cza2 | 173 | 5,26502 |
| 8Di5m | 195 | 9,44090 |
| 8Dic7 | 160 | 9,77123 |
| 8Dkd9 | 162 | 4,64968 |
| 8F2Xg | 157 | 10,40960 |
| 8F6T1 | 162 | 4,57897 |
| 8FQe8 | 177 | 7,80333 |
| 8FXqS | 173 | 8,94152 |
| 8Fg4W | 177 | 9,19456 |
| 8GJdl | 162 | 9,67446 |
| 8bbVD | 142 | 9,43696 |
| 8biY4 | 154 | 5,52977 |
| 8cuIo | 184 | 6,10226 |
| 8nrDD | 174 | 6,19712 |
| 8wZe9 | 133 | 9,86755 |
| 8xUys | 161 | 10,05412 |
| 8xWht | 168 | 9,72146 |
| 8xjBs | 154 | 4,89630 |
| 8xngg | 179 | 9,40105 |
| 8xySx | 179 | 9,40105 |
| 8y1ZF | 168 | 9,55752 |
| 8yEWR | 161 | 10,09016 |
| 8ynTg | 173 | 6,01768 |
| 8yrTl | 179 | 9,40105 |
| 8yxuP | 142 | 9,08219 |
| AxZm | 162 | 8,99252 |
| HfOl | 145 | 7,95690 |
| PoCM | 156 | 8,77191 |
| WS4G | 177 | 8,92444 |
| Wzlz | 192 | 9,62682 |
| X8zG | 126 | 9,35116 |
| dSqq | 173 | 5,83892 |
| k7o5 | 195 | 6,95422 |
| ppO | 155 | 8,54420 |
| vG0G | 103 | 4,84646 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_46
7Exor
|
250 | 35,0% | 140 | 6.527E-51 |
| 2 |
phalp2_5196
3O9Fp
|
630 | 29,1% | 151 | 2.847E-28 |
| 3 |
phalp2_4079
1lhaR
|
1 | 35,7% | 123 | 2.974E-23 |
| 4 |
phalp2_2751
7yxpI
|
42 | 31,7% | 126 | 1.588E-18 |
| 5 |
phalp2_11846
8fsBr
|
1 | 26,0% | 119 | 2.695E-13 |
| 6 |
phalp2_21013
4IiQ
|
26 | 23,1% | 138 | 9.200E-13 |
| 7 |
phalp2_1124
18Iz
|
3 | 24,6% | 138 | 4.911E-11 |
| 8 |
phalp2_10835
4edjb
|
3 | 25,0% | 124 | 1.663E-10 |
| 9 |
phalp2_28345
1din1
|
3 | 17,6% | 130 | 5.277E-08 |
Domains
Domains
1
192 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(6AJjn)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50