Protein
- Protein accession
- QdMk [EnVhog]
- Representative
- 7R5SF
- Source
- EnVhog (cluster: phalp2_40627)
- Protein name
- QdMk
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MQLTHDQLRAATGCTPARAEAWLPHIAQACEVFGINTPARLAAFLAQIGHESGRLVYVREIWGPTQAQQRYEGRADLGNTQPGDGKRYMGRGLIQTTGRANYAATRDGLAAYLPHVPDFEAVPALLERPDMAAMSAAWYWHSRGLNALADTGDFVRITKRINGGTNGLADRQALYAAAQEVLA
- Physico‐chemical
properties -
protein length: 183 AA molecular weight: 19888,2 Da isoelectric point: 7,85 hydropathy: -0,29
Representative Protein Details
- Accession
- 7R5SF
- Protein name
- 7R5SF
- Sequence length
- 172 AA
- Molecular weight
- N/A Da
- Isoelectric point
- 9,78909
- Sequence
-
MPITEQQLLQILSSAGPRAGIFLPALNAAMDKYGIAGRLRVAAFIAQVGHESGQLRWLREIWGPTPTQAGYEGRKDLGNTQPGDGSKYRGRGLIQITGRANYESCGKALGLDLIAAPELLEHXXXXLVARNLGADPSAGWLRGPKRPWQHSPVRRLEIPWARADSNYWTCKL
Other Proteins in cluster: phalp2_40627
| Total (incl. this protein): 154 | Avg length: 185,9 | Avg pI: 8,71 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 7R5SF | 172 | 9,78909 |
| 11hA7 | 144 | 11,45399 |
| 11hUu | 185 | 9,01528 |
| 11oad | 182 | 9,17761 |
| 19UM6 | 175 | 8,03039 |
| 1Gw9w | 181 | 9,78844 |
| 1GzdP | 182 | 9,02746 |
| 1HZbd | 233 | 10,21742 |
| 1I02E | 182 | 8,48941 |
| 1KvK6 | 176 | 9,42259 |
| 1Lw7i | 225 | 9,03874 |
| 1NByI | 190 | 6,42573 |
| 1NUdE | 187 | 9,65493 |
| 1OMbZ | 182 | 9,38075 |
| 1XzCf | 179 | 5,31447 |
| 1bCYX | 203 | 9,79953 |
| 1bD1n | 203 | 9,85246 |
| 1bpRV | 202 | 6,76119 |
| 1eWRY | 182 | 8,50411 |
| 1eWRm | 182 | 8,38832 |
| 1gPn0 | 185 | 9,31815 |
| 1go3s | 194 | 8,69216 |
| 1j59Y | 185 | 5,48982 |
| 1j6pZ | 205 | 5,45463 |
| 1oNI1 | 187 | 9,02449 |
| 1oNlq | 151 | 8,81517 |
| 2AXOo | 188 | 9,96393 |
| 2AYgN | 188 | 10,28511 |
| 2LBc8 | 176 | 9,60432 |
| 2SZsh | 188 | 9,59568 |
| 2UstF | 181 | 8,70873 |
| 2UuwG | 177 | 9,41001 |
| 2V6Ue | 191 | 6,83366 |
| 2Xkb4 | 176 | 9,43890 |
| 2cJEc | 214 | 8,68610 |
| 2jGNQ | 185 | 9,24207 |
| 2lL9Y | 180 | 5,88138 |
| 2lLza | 180 | 5,66283 |
| 2shdT | 187 | 9,41182 |
| 2tEqb | 174 | 9,49486 |
| 2wJH4 | 185 | 9,24923 |
| 35fuU | 203 | 8,66405 |
| 3OA6K | 232 | 9,13751 |
| 3fEdc | 192 | 5,80198 |
| 3gGcm | 206 | 8,92882 |
| 3i8f | 191 | 9,16729 |
| 45b1m | 201 | 6,49524 |
| 4DGlR | 182 | 8,51932 |
| 4GoEI | 182 | 7,01987 |
| 4KB6l | 184 | 6,40492 |
| 4KuKE | 198 | 9,94220 |
| 4MC4L | 207 | 8,29052 |
| 4MIpn | 184 | 6,04729 |
| 4MOU4 | 134 | 9,02778 |
| 4MyG6 | 183 | 6,40856 |
| 4MzMo | 168 | 9,41588 |
| 4N191 | 192 | 9,86742 |
| 4QtYH | 173 | 7,78406 |
| 4Ttfm | 184 | 5,77293 |
| 4Xu2f | 203 | 9,62096 |
| 4Yjez | 176 | 9,69226 |
| 4dSxm | 178 | 4,90631 |
| 4jNhD | 183 | 6,73595 |
| 4jjQQ | 193 | 6,06935 |
| 4pUu7 | 191 | 9,73210 |
| 4uDoL | 205 | 6,62722 |
| 4w3qT | 178 | 6,13852 |
| 5AGkE | 130 | 10,52848 |
| 5EX8U | 184 | 6,33734 |
| 5H6Hj | 183 | 6,28443 |
| 5IGgp | 191 | 10,54292 |
| 5y025 | 181 | 9,41627 |
| 6DMI6 | 223 | 7,84614 |
| 6DpGd | 191 | 8,56413 |
| 6DwTy | 151 | 9,45688 |
| 6EkwW | 175 | 6,82207 |
| 6F7pL | 185 | 8,66444 |
| 6H9sE | 175 | 5,40638 |
| 6IwQU | 190 | 10,44937 |
| 6KsU2 | 188 | 8,30844 |
| 6ObEZ | 175 | 6,89925 |
| 6PQib | 193 | 9,71914 |
| 6Phm6 | 171 | 9,73622 |
| 6RBjc | 221 | 6,73794 |
| 6RwbQ | 216 | 8,68545 |
| 6Rwiw | 215 | 7,82512 |
| 6SiXg | 176 | 9,35876 |
| 6SkLj | 154 | 9,84872 |
| 6SuDE | 188 | 9,59568 |
| 6Tq2u | 175 | 9,56583 |
| 6WVoZ | 203 | 9,91132 |
| 6aV9Y | 178 | 9,23382 |
| 6x4N3 | 201 | 8,57986 |
| 72Lda | 183 | 9,46146 |
| 7566l | 187 | 9,49357 |
| 757OA | 181 | 9,34948 |
| 76nQn | 182 | 9,56822 |
| 77VH | 188 | 9,59407 |
| 79vqB | 182 | 9,58769 |
| 7ASZx | 178 | 8,65883 |
| 7BDsU | 181 | 9,56828 |
| 7Bict | 183 | 9,42220 |
| 7IzTb | 173 | 9,45733 |
| 7LBhW | 181 | 9,49750 |
| 7WPHc | 197 | 9,65622 |
| 7aLAT | 182 | 10,13516 |
| 7bfAU | 187 | 9,59568 |
| 7cI94 | 177 | 7,77469 |
| 7cJHn | 185 | 9,98797 |
| 7dNcT | 181 | 8,76037 |
| 7dbz6 | 191 | 9,96393 |
| 7dhAH | 181 | 9,55655 |
| 7iVWE | 203 | 9,79953 |
| 7kQaM | 183 | 9,42213 |
| 7sEKE | 200 | 9,59807 |
| 7tXHI | 187 | 9,49357 |
| 7tXMt | 182 | 10,09177 |
| 7taov | 185 | 9,85536 |
| 7vOom | 182 | 9,05840 |
| 7wJQe | 187 | 9,02385 |
| 7whXu | 210 | 6,59647 |
| 7wjd8 | 183 | 9,42213 |
| 7yqRR | 205 | 9,99191 |
| 7z3LH | 181 | 7,13974 |
| 7z4Mg | 187 | 9,82384 |
| 80xw8 | 185 | 9,29262 |
| 877xa | 180 | 5,31509 |
| 89iuD | 178 | 9,62508 |
| 8HmRZ | 178 | 6,42618 |
| 8a8KJ | 176 | 9,57260 |
| 8aRaO | 189 | 10,23134 |
| 8evMC | 177 | 9,44837 |
| 8fpbn | 176 | 9,63572 |
| 8iH0i | 179 | 6,15978 |
| 8iVZq | 189 | 10,23134 |
| 8lR3b | 204 | 9,71089 |
| 8nZfG | 176 | 9,60297 |
| 8om2R | 176 | 9,67169 |
| 8oqPm | 176 | 9,48667 |
| 8rToq | 197 | 9,65628 |
| 8tAGf | 175 | 9,35025 |
| 8tXvF | 176 | 9,44599 |
| blsj | 176 | 7,79998 |
| bsgg | 185 | 8,85333 |
| cGqK | 187 | 9,49369 |
| gASC | 182 | 10,30451 |
| gU7V | 181 | 8,97298 |
| nUEy | 191 | 9,45630 |
| sD1P | 199 | 9,05583 |
| t3BW | 225 | 9,17728 |
| A0A059VA40 | 177 | 9,16336 |
| A0A6M3TDJ6 | 177 | 9,09638 |
| A0A6M3TDY4 | 177 | 9,09638 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_1654
8rD3A
|
4011 | 57,6% | 156 | 4.240E-62 |
| 2 |
phalp2_23254
4Uvr8
|
48 | 51,9% | 156 | 1.921E-57 |
| 3 |
phalp2_22262
7pbAz
|
301 | 58,0% | 131 | 1.796E-53 |
| 4 |
phalp2_82
4Uvd5
|
73 | 43,8% | 171 | 8.094E-49 |
| 5 |
phalp2_17227
3zUSo
|
139 | 46,2% | 147 | 1.136E-45 |
| 6 |
phalp2_8404
IwNf
|
80 | 53,2% | 124 | 1.281E-43 |
| 7 |
phalp2_37433
2Fv3r
|
11643 | 38,3% | 167 | 1.072E-38 |
| 8 |
phalp2_36134
6NUh4
|
42 | 36,8% | 171 | 7.081E-38 |
| 9 |
phalp2_5234
8cPFI
|
3482 | 35,3% | 184 | 6.408E-37 |
| 10 |
phalp2_12287
7e8ZJ
|
95 | 36,7% | 155 | 7.177E-35 |
Domains
Domains
1
172 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(7R5SF)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50