Protein
- Protein accession
- QPkf [EnVhog]
- Representative
- 3LHkO
- Source
- EnVhog (cluster: phalp2_31152)
- Protein name
- QPkf
- Lysin probability
- 95%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MEVKDHILFDGCKPVAYRPTPNIGGTLNPGYIVMHYDAASNATSAIHWMMNKESKVSAHLHISREGVVTQLAPFNRVCWHAGKSSWKGLTGMNSYSIGIELQNNGKEAYTAIQLEVAKSVCLTLAKTYPIKEVVGHSDIAPGRKVDPGAHFPMATFKHLVK
- Physico‐chemical
properties -
protein length: 161 AA molecular weight: 17644,2 Da isoelectric point: 9,13 hydropathy: -0,18
Representative Protein Details
- Accession
- 3LHkO
- Protein name
- 3LHkO
- Sequence length
- 219 AA
- Molecular weight
- 24874,19370 Da
- Isoelectric point
- 8,75856
- Sequence
-
MQIINHKLVGEGIKHIPSPHHSSLVDVRYIIIHYTAGRGLDQTVKTFQSWHKTVSAHLVIGKDGRVVQMVPFDRAAWHAGRSRWGELTGMNKYSIGIELDNYGRLDQVEDGYQTWFGVRVDPGSVVQIVHQFGGPMCGWESYPDEQIDKLVHICAMLYYDYHVIEILGHDDIAPGRKLDPGPAFPMKRFKTSVWSAFKKRVLTQDVKSIRGASKITSEY
Other Proteins in cluster: phalp2_31152
| Total (incl. this protein): 133 | Avg length: 208,3 | Avg pI: 8,30 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 3LHkO | 219 | 8,75856 |
| 11maq | 193 | 6,43209 |
| 13fR4 | 208 | 9,24117 |
| 13gpZ | 205 | 9,84311 |
| 149fX | 195 | 8,57708 |
| 152zt | 201 | 8,37781 |
| 175wQ | 196 | 7,77645 |
| 19xiW | 176 | 7,07858 |
| 1Cid2 | 217 | 5,89190 |
| 1EY3e | 225 | 9,99307 |
| 1FAuI | 226 | 9,84601 |
| 1I2i7 | 162 | 6,09942 |
| 1QhC9 | 204 | 9,43367 |
| 1R0yb | 200 | 5,78203 |
| 1YXgj | 204 | 6,62142 |
| 1a3e7 | 162 | 9,26870 |
| 1bISK | 162 | 9,38029 |
| 1bLus | 230 | 9,28179 |
| 1bR6Y | 162 | 9,23962 |
| 1bXnX | 165 | 9,48841 |
| 1btDW | 227 | 9,31783 |
| 1c0w1 | 232 | 9,01482 |
| 1c55J | 165 | 9,23930 |
| 1cgDz | 236 | 8,68178 |
| 1ci8U | 234 | 9,47068 |
| 1cicG | 227 | 9,28211 |
| 1dgYe | 206 | 8,82290 |
| 1duXh | 227 | 9,56100 |
| 1eVYC | 155 | 9,67685 |
| 1eW4I | 231 | 9,58343 |
| 1eW6W | 157 | 9,22802 |
| 1eXC8 | 226 | 8,61667 |
| 1en3I | 236 | 9,26464 |
| 1hdxG | 187 | 9,25484 |
| 1lNuy | 210 | 9,12461 |
| 1lQeZ | 225 | 8,85539 |
| 1laVA | 196 | 6,37986 |
| 1liu1 | 212 | 6,83110 |
| 1mPae | 237 | 5,79231 |
| 1wucy | 187 | 7,87425 |
| 1wxV3 | 187 | 7,87425 |
| 2ELJ3 | 204 | 6,82690 |
| 2Ggb6 | 187 | 9,25452 |
| 2I9kC | 187 | 8,92612 |
| 2JUzM | 162 | 8,99232 |
| 2QAhR | 187 | 9,25452 |
| 2QtC1 | 170 | 9,75447 |
| 2QzdR | 259 | 8,89872 |
| 2ZVwB | 211 | 9,41898 |
| 2eQcL | 164 | 9,18676 |
| 2ecJB | 220 | 6,47228 |
| 2fYde | 205 | 8,71247 |
| 2j2zU | 165 | 7,77600 |
| 2lLHg | 254 | 9,75157 |
| 2lfv9 | 272 | 8,22509 |
| 361wX | 205 | 8,97569 |
| 37chq | 205 | 9,66905 |
| 3MyVW | 230 | 9,28159 |
| 3NvbA | 214 | 9,73964 |
| 3NzZS | 213 | 7,93549 |
| 3V58D | 284 | 6,13181 |
| 3WWxp | 206 | 9,60245 |
| 3ZBvV | 216 | 9,09592 |
| 3hr8v | 232 | 5,82556 |
| 3nq0x | 200 | 6,21747 |
| 49ArQ | 209 | 9,60303 |
| 49lz4 | 206 | 9,44373 |
| 4CSFT | 206 | 7,22324 |
| 4Dwk9 | 225 | 6,70935 |
| 4GJsB | 165 | 5,30498 |
| 4MoBN | 265 | 5,18812 |
| 4SoYJ | 189 | 9,94472 |
| 4Sp1J | 187 | 7,87425 |
| 4UiRf | 165 | 4,96713 |
| 4VpCF | 285 | 8,97408 |
| 4VpCW | 283 | 6,85890 |
| 4et9g | 204 | 9,89501 |
| 4f1Io | 225 | 9,55539 |
| 4f4Bl | 164 | 9,07671 |
| 4gKI2 | 204 | 9,78761 |
| 4gaXi | 190 | 6,42249 |
| 4idO6 | 227 | 9,54669 |
| 4jUST | 164 | 6,17876 |
| 4kAdt | 220 | 5,95999 |
| 4kVGm | 226 | 8,45240 |
| 4kmOo | 212 | 8,66747 |
| 4sT3y | 162 | 8,74696 |
| 4tsBv | 178 | 9,00187 |
| 4uFXw | 283 | 6,85890 |
| 4vxZP | 162 | 8,53724 |
| 5BjRc | 206 | 6,65325 |
| 5Ew0Q | 204 | 9,19385 |
| 5Hcqt | 214 | 6,39560 |
| 5Ih5S | 208 | 6,48234 |
| 5iqFh | 234 | 9,22499 |
| 5jbwx | 202 | 9,47493 |
| 6Qtpt | 187 | 6,78324 |
| 6RU1p | 206 | 7,27092 |
| 6RUQ8 | 206 | 6,74806 |
| 6RVRs | 206 | 6,74795 |
| 6RgQF | 270 | 5,32180 |
| 6VEWq | 229 | 9,15298 |
| 7ImNT | 256 | 9,66434 |
| 7IpE0 | 198 | 8,26622 |
| 7UpIf | 187 | 8,92586 |
| 7VbYe | 160 | 9,57563 |
| 7cOsy | 259 | 9,54114 |
| 7dqua | 227 | 9,13183 |
| 7lNNq | 244 | 7,92479 |
| 7rZrn | 201 | 5,57621 |
| 7wIHl | 259 | 9,27096 |
| 7woyp | 157 | 9,13422 |
| 7yiNC | 227 | 8,95751 |
| 83Mc0 | 188 | 8,27789 |
| 8ake3 | 208 | 9,68091 |
| 8bZHt | 187 | 8,95442 |
| 8eW5X | 188 | 8,27789 |
| 8elAi | 217 | 7,01646 |
| 8encY | 216 | 6,44318 |
| 8kch4 | 267 | 9,57061 |
| 8qdJu | 204 | 9,80185 |
| AzR | 162 | 8,76133 |
| RrmL | 193 | 10,00467 |
| XMZY | 215 | 6,37872 |
| bjsw | 207 | 5,96931 |
| e5Mj | 187 | 9,11784 |
| k44A | 215 | 7,02424 |
| kZfl | 257 | 9,05228 |
| lVPm | 204 | 6,89363 |
| nVnH | 187 | 9,49331 |
| sRNL | 206 | 9,35979 |
| A0A223VZK2 | 313 | 8,61145 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_36096
6F3wF
|
69 | 39,1% | 199 | 3.693E-75 |
| 2 |
phalp2_22919
33qi6
|
180 | 37,5% | 197 | 2.214E-73 |
| 3 |
phalp2_4783
4YJpR
|
19 | 36,3% | 223 | 6.621E-65 |
| 4 |
phalp2_24979
ze0C
|
8 | 36,4% | 195 | 6.856E-56 |
| 5 |
phalp2_9775
84cP5
|
1 | 35,1% | 185 | 1.286E-55 |
| 6 |
phalp2_40199
2cSYZ
|
15 | 32,8% | 219 | 5.586E-54 |
| 7 |
phalp2_11760
45aqa
|
242 | 37,1% | 183 | 2.993E-51 |
| 8 |
phalp2_2346
4ToIc
|
3 | 27,2% | 198 | 6.919E-50 |
| 9 |
phalp2_31437
3j8r5
|
5 | 36,8% | 206 | 1.297E-49 |
| 10 |
phalp2_6728
24ioh
|
33 | 32,5% | 206 | 1.295E-46 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(3LHkO)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50