Protein

Protein accession
LmVS [EnVhog]
Representative
1ZwF3
Source
EnVhog (cluster: phalp2_4186)
Protein name
LmVS
Lysin probability
90%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MQPAQATNADHYKLYAHSRIINDQQYICFKRIIYKESRWNPMAKNGSHYGLGQMRSTHYRELDPYRQIDATIKYIKKRYGSMCKAWAFHQKKGYY
Physico‐chemical
properties
protein length:95 AA
molecular weight:11472,0 Da
isoelectric point:9,81
hydropathy:-1,00
Representative Protein Details
Accession
1ZwF3
Protein name
1ZwF3
Sequence length
77 AA
Molecular weight
8859,05470 Da
Isoelectric point
7,93427
Sequence
MRRTLLILGITLALLAAPQASASKDWKDHPMNYKLHAYNLLLDFEEFQCIVELYEKESNWRPSARNGSHFGIPQGRS
Other Proteins in cluster: phalp2_4186
Total (incl. this protein): 162 Avg length: 117,7 Avg pI: 9,61

Protein ID Length (AA) pI
1ZwF3 77 7,93427
12Wx8 161 10,08313
18L3p 132 9,73777
18Q6T 105 9,54340
19HBm 122 10,18022
19O1Y 105 9,51671
1JNZR 110 10,18035
1KaHi 161 9,76704
1KaIe 153 9,60284
1Kfvf 60 9,51703
1Mufl 151 8,32875
1dZAB 96 10,01260
1h2J4 110 9,72726
1h43l 112 9,61612
1jzRU 113 9,54211
1snn2 89 9,78109
1tKTn 142 9,86897
1yicm 135 9,27650
1z8vp 106 9,95729
25OyR 75 9,86664
2Y0K6 127 9,75092
2j8jm 174 9,15098
2j91F 138 9,27985
2jb58 149 9,86742
2jenI 142 9,47732
31o2S 120 9,82448
321mo 70 9,66338
32POy 115 9,72933
32V9p 131 9,86400
32YeS 174 9,37739
32crH 174 9,26806
38ccE 188 10,43016
38m0Y 152 9,75389
3VVWE 164 9,91055
3bmoC 81 9,71927
44Ipn 84 10,01969
46NS1 132 9,96780
48M8K 155 9,50846
48fGs 153 9,45334
48fwt 135 10,05541
499ke 178 10,00867
4CdX0 159 9,97489
4NAAX 72 9,41549
4NwYA 96 9,69548
4O5zE 109 8,52332
4QTbB 97 9,46836
4a6Qy 153 9,48680
4bOmy 154 9,84988
4h7G7 96 9,77632
4m7Bx 96 9,89495
4md56 112 9,62650
4mdK8 96 9,94974
4mocj 110 9,75789
4n71V 112 9,56764
4nFB4 128 9,48744
4naX1 96 9,56880
4oVcx 112 9,48815
4pmgT 112 9,54527
4poqu 96 9,84730
4rAsw 178 9,91835
4rQE8 95 9,69632
4rSn8 90 6,89209
4rVmF 110 9,81094
4sb8U 112 9,59620
4wp32 109 9,67092
501LJ 126 10,42011
50tEH 96 10,07385
518A5 110 9,81094
52ERw 110 9,58672
535xw 105 9,35090
53CrL 112 9,48776
54oda 112 9,59620
56Egr 112 9,46256
56xc9 112 9,51549
56yLS 112 9,54172
56yQw 109 9,86948
58LNK 97 9,75814
58NwN 95 9,89804
598Dn 71 9,56493
59ZNJ 96 9,66022
5AZXc 104 9,72900
5aav8 121 9,73197
5acbK 112 9,69593
5ccq3 112 9,62650
5d1fe 128 9,66441
5eFBl 109 9,63830
5eWAg 165 10,04161
5eelS 96 9,69393
5erk0 159 10,02105
5fT48 112 9,48822
5fnTV 96 9,94974
5fsMw 96 9,65977
5g6oP 112 9,69497
5gMtb 112 9,48847
5gn4Y 96 10,01092
5iHqo 92 9,42697
5iRGP 159 10,25107
5iasL 112 9,48783
5icjh 109 6,89005
5jfbQ 64 8,93450
5kNrV 110 9,69832
5kPXe 103 9,59001
5l5Rq 93 9,78303
5l7EJ 117 9,48157
5mTnQ 112 9,69497
5n1cV 58 7,92924
5nwFo 158 10,02001
5o2qO 112 9,51587
5tsLv 152 9,40763
5ulW0 97 9,69484
5vMlt 126 10,42011
5vPDP 96 9,82519
5vrry 112 9,51549
5vxqK 66 9,41607
5w4g2 107 7,92660
5wPRK 161 9,85568
5wXVr 112 9,48776
5wYI1 179 9,90571
5wtJo 153 9,59233
5x3bC 112 9,48815
5xSYM 121 9,72746
5y4Bf 112 9,48815
5y6hl 112 9,62650
5z7Li 112 9,46256
5zfvv 96 10,01092
6Ay3p 104 9,54572
6AzZj 111 9,71050
6Gmi2 97 9,73197
6IFD7 112 9,54566
6Isyl 95 9,82487
6KS2t 96 9,41588
6MLIY 95 9,72507
6Mrbk 100 9,30074
6xOFB 80 9,33504
6xutW 109 9,72352
6yI5c 166 10,04909
6yaZU 151 8,95751
6z0ju 96 10,06463
6zaZV 169 9,91048
87cqO 150 9,93369
88sKa 106 9,54372
8FXwO 115 9,51626
8mwal 96 9,89591
8oSST 138 9,84066
BURE 115 9,41936
C8WB 122 9,75640
C8Wb 155 9,69303
G0Sl 112 9,51587
IHfW 112 9,62605
S1vJ 120 9,28056
SOmw 110 9,75112
SPtA 179 9,28437
Stdl 98 9,69729
Sx6W 95 9,56880
T9Lh 115 9,69671
TCwr 174 9,37739
UdCU 153 9,53283
UoMx 96 9,80379
UyoG 96 9,94858
t4VT 155 9,66602
t5J2 105 9,46410
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_2408
4Yeka
404 43,6% 71 7.513E-18
2 phalp2_34185
2JiXO
11 41,7% 67 1.120E-14
3 phalp2_18298
57J38
2 39,3% 66 2.143E-10
4 phalp2_2439
5hDKy
5 41,3% 58 5.568E-10
5 phalp2_30553
5CWOA
1 43,2% 67 1.989E-09
6 phalp2_34644
5wXUO
3 28,1% 64 4.802E-08
7 phalp2_14710
6zGSB
2 27,6% 47 8.442E-07
8 phalp2_11122
5nuC5
3 35,3% 65 1.161E-06
9 phalp2_5567
3Wp4H
119 28,1% 71 2.810E-05
10 phalp2_17642
6LXup
5 36,3% 66 7.311E-05

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 1ZwF3 (77 AA)
Member sequence: LmVS (95 AA)
1 77 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1ZwF3) rather than this protein.
PDB ID
1ZwF3
Method AlphaFoldv2
Resolution 79.45
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50