Protein

Protein accession
G12l [EnVhog]
Representative
47zsl
Source
EnVhog (cluster: phalp2_18104)
Protein name
G12l
Lysin probability
88%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MPMVLLPSYYTRLSSLERRVERQKNVSSFIASIVISWCVSGICWIEEISPEAQAIAACESGNTITLGSLNWAAINVNVDGTIDGGAFQFNNYWVWNSQDRWVMRPVAKRIGITSDALFLRYPSADVADPYVQYQTFIYLWDNGYGWQHWSASRPCWSKWLTVQKGRAVWKN
Physico‐chemical
properties
protein length:171 AA
molecular weight:19610,1 Da
isoelectric point:8,36
hydropathy:-0,12
Representative Protein Details
Accession
47zsl
Protein name
47zsl
Sequence length
122 AA
Molecular weight
14145,58340 Da
Isoelectric point
5,20073
Sequence
MILLEVFLALICHGGVCHTDRIYVTREAMAIATCESGDAYNYGTYDFTARSATMDGGAWQFNDRTYEWLVGRSHAEEDTPQSQYNAFIRLWNNGKGWRHWSASQPCWDKWIVIDDDSRAVWR
Other Proteins in cluster: phalp2_18104
Total (incl. this protein): 176 Avg length: 129,4 Avg pI: 5,33

Protein ID Length (AA) pI
47zsl 122 5,20073
19IKl 94 5,08302
1IKVy 122 5,89116
1INjD 122 5,14702
1IV8l 104 4,83281
1JIXQ 122 5,02101
1JJEL 122 6,25413
1JLih 123 5,28446
1JXtI 122 5,43957
1JZtu 122 5,90019
1JjTe 128 6,05474
1Jl3W 123 5,51454
1JnTH 132 5,78220
1JoX6 120 4,55482
1JxEe 122 6,39236
1K8O1 121 7,67528
1KYVz 104 5,05636
1Kee4 120 4,91375
1KlnI 122 4,98969
1LYnA 123 4,96030
1LcYE 121 5,46600
1LflF 122 5,01686
1LiHb 116 5,38779
1MhFW 120 5,10416
1Mht6 120 4,65445
1MpIa 122 8,40360
1MpgE 122 5,71996
1MpiU 121 5,83085
1MrnM 120 4,86192
1MwCr 120 5,07995
1MxTo 136 4,97690
1aAkp 120 5,14719
1eDy7 124 6,54026
1pGRN 123 6,15210
1pHV7 109 4,49718
1qkPb 139 4,23311
1znHA 122 6,80302
219JN 121 4,92921
21eLs 120 5,14719
24wGx 123 6,07753
2Gzxd 124 6,80615
2HNQ3 125 4,94058
2VNVG 122 7,70455
2YDM5 120 5,36420
2YeSe 122 4,92506
2qlCs 146 4,64843
2rX8s 171 8,36376
31Dj7 142 5,34340
32PCi 122 5,62674
33xlQ 122 4,90841
33zwG 123 5,11206
36RVS 121 4,92921
38nda 152 5,04215
3UFb9 125 5,90525
3UweB 99 6,10481
3W0Pl 122 5,51034
3YLjh 125 5,49777
3jAUF 122 6,48831
43UuH 143 5,25678
43ur4 141 4,51014
44wBj 125 5,51454
46A3k 104 5,38620
46AlK 121 5,55103
46CiF 121 4,73028
47xK7 120 5,15663
48ZmH 120 4,99788
492Cs 122 5,81454
49KQi 122 5,01686
49Sp8 157 4,56220
49wIQ 122 5,22660
4A9kf 145 4,76887
4Cm8r 122 4,99947
4IYpA 141 4,88329
4NBeH 123 5,83079
4NMT2 125 4,78558
4a1hU 123 6,26646
4aBYF 121 5,83995
4aKoS 120 5,08541
4bF0z 121 4,90250
4gpFg 121 4,78660
4l5aq 146 4,79894
4l8iB 123 4,82599
4lcLn 143 5,30503
4nIjP 122 5,71058
4oTf8 128 7,73803
4qfa2 143 4,27500
4vmYE 143 4,36634
4zTBW 133 5,62276
50gNQ 172 9,28108
51f1W 141 4,87789
52ivD 146 4,50826
53HT0 122 5,87581
53IsL 121 6,25123
5620O 141 4,62956
563yQ 137 4,43170
58TJf 140 4,55538
58Utv 146 4,49349
58nD6 143 4,27500
59u7e 140 4,23976
5AEHx 143 4,68066
5AxhL 146 4,17013
5Br7T 134 4,29904
5Cd90 122 5,43554
5dAFz 129 5,46600
5dmeg 143 6,03774
5eTDO 184 5,61657
5ebs4 137 4,32922
5fkMA 146 4,47081
5iFxS 100 5,10911
5kC53 143 5,75707
5l5Dv 126 4,52520
5lbcJ 122 5,90213
5lcX1 122 5,42440
5liWe 131 4,26192
5lkF2 122 5,39234
5lkSZ 124 5,18971
5lzzn 123 5,38762
5m7ic 141 4,33644
5mqAs 125 5,51454
5vm84 123 6,26635
5wKY9 122 5,23330
5wMwf 107 5,43968
5x906 122 6,35513
5xYdS 137 4,32922
5zqrZ 133 4,20776
6AwmV 120 6,01512
6GUCr 122 4,87078
6GZdR 131 4,23925
6GmMt 131 4,30114
6Got1 127 4,28136
6Hj5y 122 5,18579
6HjbN 122 5,90213
6IAtY 146 4,34531
6KybV 129 5,01487
6LBoP 128 4,80650
6LDsy 127 4,67287
6MB2O 120 6,15199
6xa4V 140 4,55538
6xqzP 136 5,59764
6xrzg 123 5,15555
7WKhC 142 5,47089
804Pb 145 4,49394
81YMD 146 4,37572
84vN9 121 4,60131
87c2z 122 6,25152
88067 121 5,83085
8bu6S 149 4,20315
8eMAn 123 4,56482
8ePKL 132 5,85745
8jqxN 128 5,14702
8mrkI 122 4,86459
8mrux 122 5,38466
8nlLJ 177 5,35329
8nw3b 120 4,29012
8oTYo 138 4,63223
8oWbt 145 4,40374
8osfH 120 4,99492
8rbGb 145 4,41999
8vMed 146 4,15137
Cb7J 120 4,95132
FTPu 121 4,99134
IT1N 122 5,83716
J0Cr 143 5,36136
J9KV 149 5,03147
JnfO 98 7,95819
L03w 122 5,00060
LDhO 122 5,49220
MHZM 144 5,47328
RZ5u 141 4,53373
SfIl 182 6,00859
UaqS 141 5,24223
Uf8T 122 5,68546
bYe6 123 5,47993
h4Cf 142 4,46330
heMO 171 8,70370
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_27960
JgeR
2 54,1% 85 1.175E-35
2 phalp2_25490
3bAzw
5 31,9% 97 5.998E-15
3 phalp2_17822
8DJo2
441 33,3% 84 1.036E-10
4 phalp2_26885
4fXxN
3 26,8% 82 2.073E-05
5 phalp2_28381
1o9gv
124 26,4% 106 1.826E-04

Domains

Domains
Unannotated
Representative sequence (used for alignment): 47zsl (122 AA)
Member sequence: G12l (171 AA)
1 122 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (47zsl) rather than this protein.
PDB ID
47zsl
Method AlphaFoldv2
Resolution 94.35
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50