Protein
- Protein accession
- FoIt [EnVhog]
- Representative
- 72lJ7
- Source
- EnVhog (cluster: phalp2_6321)
- Protein name
- FoIt
- Lysin probability
- 79%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MKDNFEECLAHVLKHEGGYVDHPKDPGGATNLGATKKVWEEWVGHEVTKDDIRALTVADVAPLAWGGLCCF
- Physico‐chemical
properties -
protein length: 71 AA molecular weight: 7777,7 Da isoelectric point: 5,13 hydropathy: -0,28
Representative Protein Details
- Accession
- 72lJ7
- Protein name
- 72lJ7
- Sequence length
- 117 AA
- Molecular weight
- 12600,98090 Da
- Isoelectric point
- 9,04616
- Sequence
-
MDRNFARALPLVLKHEGGWADNPKDPGGATMNGVTLATFRRYVKADASKADLRAISDDQVATVYYRHYWAAVNAQALPSGIDYAVFDFAVNSGPARAARYLQSIAGVSVDGRVGPQT
Other Proteins in cluster: phalp2_6321
| Total (incl. this protein): 149 | Avg length: 132,1 | Avg pI: 6,55 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 72lJ7 | 117 | 9,04616 |
| 17Val | 61 | 5,44986 |
| 18lbL | 106 | 4,64093 |
| 191Qs | 63 | 6,00893 |
| 1FdVl | 180 | 6,31489 |
| 1JE9l | 83 | 5,63254 |
| 1Jy36 | 119 | 6,07083 |
| 1K48I | 117 | 7,68471 |
| 1Lwwu | 164 | 9,04358 |
| 1Um24 | 120 | 4,97673 |
| 1W7qd | 119 | 8,33662 |
| 1cL3X | 80 | 5,17305 |
| 1fpWs | 169 | 5,26598 |
| 1g8GQ | 92 | 5,72922 |
| 1jcz1 | 115 | 6,03558 |
| 1jziv | 116 | 5,41871 |
| 1lrUx | 164 | 8,99954 |
| 1uJpT | 112 | 5,65851 |
| 1uNqU | 109 | 5,86370 |
| 1uSja | 122 | 5,03880 |
| 1vPen | 74 | 6,03001 |
| 1wCFC | 95 | 6,03644 |
| 1wpPj | 85 | 5,03755 |
| 1zmgw | 65 | 5,82471 |
| 202DJ | 105 | 4,96502 |
| 28WFe | 170 | 6,83014 |
| 29K12 | 96 | 5,86979 |
| 2Bo87 | 124 | 10,08674 |
| 2DVU3 | 95 | 4,46501 |
| 2ESm0 | 99 | 4,98327 |
| 2FyK9 | 137 | 6,08714 |
| 2Jsrd | 97 | 4,66793 |
| 2V0GI | 109 | 8,50469 |
| 2W4X4 | 130 | 5,66892 |
| 2XcIS | 170 | 9,22602 |
| 2XteE | 66 | 5,40984 |
| 2uphk | 111 | 5,20358 |
| 31Zgn | 112 | 4,88568 |
| 32zWj | 89 | 5,70740 |
| 33GG4 | 92 | 5,18499 |
| 35etT | 110 | 6,07219 |
| 37jyb | 113 | 5,22665 |
| 39N1n | 92 | 5,45026 |
| 39Tbo | 116 | 5,73525 |
| 3Ejsk | 91 | 6,02797 |
| 3FWx9 | 106 | 6,07634 |
| 3GpO5 | 127 | 5,34999 |
| 3NaVR | 93 | 4,87306 |
| 3Rldu | 170 | 9,20965 |
| 3Wdez | 170 | 6,09015 |
| 3Z6vA | 86 | 5,43968 |
| 3ZphS | 165 | 9,66525 |
| 3dfJ2 | 108 | 5,63942 |
| 43lUX | 118 | 5,15413 |
| 468wR | 82 | 5,01487 |
| 46gnT | 104 | 5,85558 |
| 4WuQI | 204 | 9,32659 |
| 4a1ud | 98 | 6,73038 |
| 4aV9l | 87 | 5,24314 |
| 4acvE | 94 | 5,84336 |
| 4bKCd | 83 | 5,26758 |
| 4e1xD | 225 | 10,19086 |
| 4eSnR | 160 | 9,00006 |
| 4nhY0 | 109 | 6,71043 |
| 4owlp | 124 | 6,71788 |
| 4quSH | 95 | 5,24063 |
| 4t4ni | 172 | 5,67579 |
| 4w0IU | 161 | 6,23310 |
| 4wJE5 | 175 | 6,83099 |
| 509vw | 93 | 5,25433 |
| 50hNW | 176 | 8,43532 |
| 56HAP | 79 | 5,72593 |
| 5ILVF | 103 | 4,76563 |
| 5hFfV | 68 | 6,99798 |
| 5kRDJ | 98 | 5,49255 |
| 5rDxX | 107 | 6,05565 |
| 5wf2f | 119 | 6,27351 |
| 6A0up | 105 | 5,72922 |
| 6Bk7j | 179 | 8,95919 |
| 6BlCo | 184 | 5,97687 |
| 6CDgy | 81 | 6,53969 |
| 6CStf | 76 | 6,39572 |
| 6DXbM | 101 | 7,83202 |
| 6HNA3 | 167 | 4,79797 |
| 6IByD | 83 | 5,63203 |
| 6IKdS | 170 | 5,91003 |
| 6KvSj | 106 | 5,11059 |
| 6McOW | 97 | 7,77008 |
| 6VfI4 | 158 | 7,79334 |
| 6Vgvd | 158 | 7,77213 |
| 6cDw | 158 | 8,17777 |
| 6y4QN | 101 | 6,05923 |
| 6zKY6 | 98 | 6,18115 |
| 7CwFc | 118 | 5,49510 |
| 7EMUl | 66 | 5,73638 |
| 7HOtY | 164 | 8,02569 |
| 7HjKR | 80 | 4,82577 |
| 7KMi0 | 114 | 5,25035 |
| 7LL1Y | 88 | 4,46473 |
| 7dspE | 118 | 5,68040 |
| 7yvkI | 155 | 7,83209 |
| 8AFla | 169 | 6,52218 |
| 8BE8g | 126 | 8,95158 |
| 8BNeq | 101 | 5,27406 |
| 8BWYq | 169 | 6,97269 |
| 8ByMR | 169 | 6,52099 |
| 8D98P | 96 | 5,26240 |
| 8F5TH | 108 | 4,95803 |
| 8GCfa | 170 | 6,96701 |
| 8GJzg | 116 | 4,79110 |
| 8GdfW | 159 | 5,50164 |
| 8GjuY | 170 | 4,52344 |
| 8l1Yc | 169 | 5,97443 |
| 8lwjt | 119 | 6,26078 |
| 8wUTc | 171 | 5,02556 |
| 8xH2G | 168 | 4,84577 |
| 8xMsJ | 170 | 6,21360 |
| 8xWtq | 169 | 7,01765 |
| 8xg2R | 168 | 4,92512 |
| 8xqNn | 172 | 5,41394 |
| 8z4cA | 159 | 5,34152 |
| 8z7Rt | 140 | 5,81045 |
| 8zF9u | 73 | 6,54708 |
| 8zufl | 169 | 5,76327 |
| FPaH | 125 | 5,91185 |
| FWj1 | 149 | 5,43713 |
| I6ZB | 173 | 10,71395 |
| MCDC | 70 | 5,72149 |
| MwFP | 70 | 5,72149 |
| Z3r6 | 119 | 7,75434 |
| ab7h | 77 | 5,22682 |
| eFAA | 96 | 4,66764 |
| tPFu | 118 | 4,95803 |
| w0Et | 114 | 5,12332 |
| y8R8 | 170 | 9,11346 |
| M4QPK9 | 209 | 9,54836 |
| A0A1L7QX96 | 241 | 10,10956 |
| A0A1L7QNW6 | 241 | 10,05760 |
| A0A1L7QP04 | 241 | 10,10956 |
| A0A1L7R181 | 241 | 10,10956 |
| A0A6C0X257 | 283 | 9,89101 |
| A0A6J5KKJ2 | 179 | 8,88937 |
| H2EIC4 | 241 | 10,10956 |
| V6F994 | 241 | 10,10956 |
| X2CXR6 | 241 | 10,10956 |
| X2CXV0 | 241 | 10,10956 |
| X2CYH6 | 241 | 10,10956 |
| X2CYM6 | 241 | 10,10956 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_12946
360Ik
|
1926 | 50,4% | 115 | 3.461E-67 |
| 2 |
phalp2_37851
4LyyS
|
5845 | 48,3% | 118 | 7.773E-55 |
| 3 |
phalp2_23908
1Le4q
|
257 | 49,1% | 118 | 2.879E-51 |
| 4 |
phalp2_25028
ZsUq
|
3460 | 38,5% | 114 | 1.401E-43 |
| 5 |
phalp2_30515
5lEwY
|
188 | 40,3% | 109 | 6.805E-43 |
| 6 |
phalp2_21282
1uMBM
|
118 | 39,4% | 71 | 5.197E-40 |
| 7 |
phalp2_18063
3IzUl
|
9 | 40,4% | 99 | 8.940E-39 |
| 8 |
phalp2_31569
4hIyC
|
214 | 37,6% | 101 | 1.929E-36 |
| 9 |
phalp2_2772
4xQC
|
10 | 36,5% | 126 | 3.318E-35 |
| 10 |
phalp2_1444
1DO8y
|
138 | 35,1% | 131 | 1.175E-34 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(72lJ7)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50