Protein

Protein accession
Db4c [EnVhog]
Representative
7B0ac
Source
EnVhog (cluster: phalp2_30749)
Protein name
Db4c
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
GIDPTKQAWTKATQLKLKDYFIKQIRAYMKGGTPKVTTVKNKPGSASTPANRRDMNGWKINKYGTYYKSEVAHFTPNTPIKTHYVGPFRSCPVSGVLQPGQTIKYDTVCKQDGHVWVSYTAYNGKDVWLAVRTWNKTNDSLGKLWGTIN
Physico‐chemical
properties
protein length:149 AA
molecular weight:16818,0 Da
isoelectric point:9,91
hydropathy:-0,70
Representative Protein Details
Accession
7B0ac
Protein name
7B0ac
Sequence length
210 AA
Molecular weight
23904,72030 Da
Isoelectric point
8,75901
Sequence
MCQSMGADNSTFLKNEQATFQECARLLKKWGLPANRNTIRLHNEFTSTSCPHRSSVLHTGFDPVTRGLLPEDKRLQLKDYFIKQIRAYMDGKIPVATVSNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPVGYQFQPGGYCDYTSVLLQDNHVWLEYEWQGNFYYIPIRSWDGTPPPNQIVGELWGTIS
Other Proteins in cluster: phalp2_30749
Total (incl. this protein): 146 Avg length: 312,5 Avg pI: 8,70

Protein ID Length (AA) pI
7B0ac 210 8,75901
1RhwD 168 9,70947
5tFp 249 9,51774
75B9L 295 8,82097
77ve9 237 8,51971
7aTPL 270 9,62811
7auDn 237 8,51120
82Zok 270 9,27205
8LHis 209 9,49382
8fsmJ 249 9,56629
oPCI 257 9,63843
ym82 179 10,01112
Q4ZA77 210 8,75901
A0A7T1JPU3 481 8,73252
S4SVK6 481 8,73252
A0A3G2YSI2 249 6,41220
A0A6M2Z157 249 7,58951
A0A7L8ZIX6 249 6,57692
Q4ZCC3 481 9,16645
A0A410T4J4 490 8,61409
Q8SDS7 490 8,48386
B8QIR1 481 8,73787
Q4ZC44 482 9,20501
Q4ZAU2 481 8,72723
A0A173G9X3 250 7,57177
M9QQN5 481 8,82316
M9NTD5 481 8,25339
A0A482MFP2 481 8,83444
A0A2H4PQR3 486 8,61899
A0A185AMW9 253 6,41709
A0A6C0R0U9 481 8,62402
Q859I7 250 8,76965
A0A2I7SBV6 249 6,19252
G9M969 253 6,88050
A0A1J0MID5 250 8,18428
A0A249Y3A0 249 5,57780
W6EBY7 250 6,41322
Q4ZE57 250 7,58968
A0A1W6JQB6 478 9,65248
B2ZZ06 481 8,72729
A0A060AB53 209 9,49382
A8D3S8 249 6,41373
G9M948 250 6,08157
A0A0E4BZI4 249 6,41629
U3PDY3 474 9,69194
A0A4D6DVY0 209 9,69613
W5RV91 428 9,72507
A0A059T7Q7 481 8,47928
A0A5J6T7H7 253 5,56490
A0A7T8C4Z3 250 6,88010
A0A0H3U310 490 8,61899
A0A3S7JLW7 249 6,81309
A0A075BEM5 209 9,69613
A0A0E3X9B3 209 9,69613
A0A0H4ITZ3 481 8,62937
A0A0H4IU50 481 8,62937
A0A0H4TIV6 209 9,69613
A0A0K1LKD3 481 8,62402
A0A1S6KVR0 209 9,69613
A0A223G0Q4 209 9,69613
A0A2I6PCW4 481 8,73252
A0A2R4SAX7 209 9,69613
A0A2S1GTR3 481 9,00889
A0A2S1P912 481 8,82870
A0A2S1P9B4 481 8,90665
A0A2S1P9B9 481 8,96892
A0A2Z4PZH1 480 9,24859
A0A2Z5HRG3 468 8,63420
A0A3G1IX81 209 9,69613
A0A3G1LE67 481 8,82877
A0A3G1LVJ4 209 9,69613
A0A410T9B9 209 9,69613
A0A410TA37 209 9,69613
A0A410TAM6 209 9,69613
A0A411BLF4 209 9,69613
A0A411BLM0 209 9,69613
A0A499SS52 482 9,10843
A0A4D5ZBI9 209 9,69613
A0A5B8R3J4 209 9,69613
A0A6M2Z201 249 6,28818
A0A8E5KB45 209 9,69613
A0EWV1 481 8,73252
F1AH96 481 8,90671
F1AH97 481 8,90671
F1AH98 481 8,90671
F1AH99 481 8,82316
F1AHA0 481 8,82316
F1AHA1 481 8,90671
G2ZIU5 209 9,69613
K7RFA9 209 9,69613
P79668 490 8,48386
Q4ZB16 481 8,73252
Q4ZB92 481 8,62937
Q4ZDC1 237 8,20027
Q4ZDT0 481 8,82316
S4SVG5 481 8,82877
Q08JW9 481 8,73252
A0A899IPR0 481 8,48386
A0AA47KWJ8 481 8,61409
A0AA96PQW6 481 8,91258
A0AAF0AHI4 481 8,73252
A0AAF0BYE6 481 8,62402
A0AAF0HGE2 250 6,41072
A0AAX3Y6V9 481 8,62402
A0A2H4IZ50 244 9,50098
A0A8E5K7T9 210 9,69613
A0A8E5K884 210 9,69613
A0A8E5K8Z1 210 9,69613
A0A8E5K9C4 210 9,69613
A0A8E5K9X5 210 9,69613
A0A8E5KAB5 210 9,69613
A0A8E5KC01 210 9,69613
A0A8E5NRH7 210 9,69613
A0A8F3C9N7 250 6,41072
A0AA50IJ32 249 6,07463
A0AAE7FJG5 229 9,29971
A0AAE7FKD0 249 9,56629
A0AAE7KC32 249 9,56629
A0AAE9ZKV1 249 5,80112
A0AAF0CKI2 249 5,80112
A0AAF0D6I5 249 9,56629
A0AAX4B753 209 9,55268
A0AAX4B7A6 209 9,55268
A0AAX4B8C7 209 9,55268
A0AAX4B8F6 209 9,55268
A0AAX4B979 209 9,55268
A0AAX4B9L4 209 9,55268
A0AAX4BA00 209 9,55268
A0AAX4BA77 209 9,55268
A0AAX4BB99 209 9,55268
A0AAX4BBS0 209 9,55268
A0AAX4BC80 209 9,55268
A0AAX4BCN9 209 9,55268
A0AAX4BD97 209 9,57299
A0AAX4BDB3 209 9,55268
A0AAX4BE60 209 9,57299
A0AAX4BER1 209 9,57299
A0AAX4BF31 70 8,71060
A0AAX4BIL4 249 6,41220
A0AAX4J5Z7 209 9,55268
A0AAX4J6U0 229 9,29971
A0AAX4JIW8 249 5,78970
A0AAX4M0B1 250 6,88095
A0AAX4PWB3 250 6,40976
A0AB39U261 249 7,57814
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_7790
7qCWn
51 38,7% 214 1.085E-57
2 phalp2_15359
1El58
3 28,2% 195 3.560E-20
3 phalp2_20292
2aQ1n
8 23,9% 213 3.528E-12
4 phalp2_24730
6BIOG
3 19,7% 203 8.441E-06
5 phalp2_28103
7vQh7
9 20,5% 214 2.136E-04

Domains

Domains
Unannotated
SH3_5
Representative sequence (used for alignment): 7B0ac (210 AA)
Member sequence: Db4c (149 AA)
1 210 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF08460

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (7B0ac) rather than this protein.
PDB ID
7B0ac
Method AlphaFoldv2
Resolution 81.37
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50