Protein

Protein accession
AqZb [EnVhog]
Representative
wIlS
Source
EnVhog (cluster: phalp2_7941)
Protein name
AqZb
Lysin probability
94%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKVGIIIGHYKKGKGAYSDFFGKSEFDFYKDLENDLSLLGDVFYHKNVPSYSVRQKLMAYKTKNYDIVFEMHFNALNEKASGCECLYYNNNSIAWELSDYFTEQYTKLSKTDKRPSKGLKKSDRGYGFVSNQKPLALLIEPFFGDNEDDCKAFNSDYLLHAMNSVIQKYKLLCLK
Physico‐chemical
properties
protein length:175 AA
molecular weight:20299,9 Da
isoelectric point:8,49
hydropathy:-0,54
Representative Protein Details
Accession
wIlS
Protein name
wIlS
Sequence length
199 AA
Molecular weight
23384,24250 Da
Isoelectric point
8,51603
Sequence
MNIMDKKFKVAILVGHNSSQQGAFSKELNMTEWQYNKEVANYLHEKDGEMYDVYFRQPHQSYRKQMQDVLDVINRKYYDLVVELHFNSHSDAQAQGSTGLHYKANSKVVEYLHLFQDMLKRVWGVVKRPLIPITKEDLNRVNGAYGILKSKADYVLLEPFFGSNPEEARKFRSYLQYADTLDRSIKKYLESVEDGRTKE
Other Proteins in cluster: phalp2_7941
Total (incl. this protein): 251 Avg length: 186,5 Avg pI: 8,06

Protein ID Length (AA) pI
wIlS 199 8,51603
18RWh 178 6,90295
1BLmm 208 5,17123
1HIP8 182 8,25287
1HVCR 169 8,68700
1Lacg 169 8,95848
1Lq99 169 8,95848
1OZL9 219 7,67943
1QpTe 214 8,41572
1al8t 175 9,18489
1bKa9 181 8,95822
1cCJZ 204 8,17106
1ce6X 203 8,19259
1ckOD 182 8,25539
1crQd 207 8,66186
1cstz 177 5,86433
1cvOk 204 8,48077
1cvY2 203 8,19259
1cwWj 182 8,74702
1cwuO 205 8,41591
1czQI 182 8,77623
1jTsI 203 8,70260
1jUWB 205 6,96360
1jV7A 210 8,48625
1knlu 206 8,87415
1npUu 247 9,15691
28gTU 189 6,95632
2AWLz 176 8,87306
2F9f 178 9,04616
2IyHN 179 6,35064
2KF0N 190 5,29526
2KVN1 180 9,17928
2MPxy 177 8,27640
2Vupz 178 9,73055
2YvEZ 162 8,96808
2YvQn 182 8,69351
2cyTq 176 8,54195
2dxdS 167 9,15311
2fYVB 201 6,92017
2ftVy 189 7,61389
2jY8X 190 5,42525
2kqXw 176 8,52480
2ksgr 167 9,04931
2lpsY 175 6,96132
2pwUD 169 9,45424
32Rw 187 4,79769
32gF 167 9,18457
34SiX 175 7,74280
3Maf 179 6,16359
3NYyx 173 4,96269
3NkTr 174 5,27269
3OmaL 152 8,58424
3REFH 173 9,09702
3Y7SX 162 7,64453
3Y8X9 169 5,73695
3Y94d 168 7,64856
3aTgY 189 9,30029
3axjh 167 9,40183
3bD8K 204 9,73461
49u0l 183 8,37278
4B74h 191 7,95535
4BIo1 174 9,32659
4JJsF 170 6,95638
4KPEf 167 9,02108
4KPUE 167 8,87196
4QFCD 182 7,64794
4UlLM 173 6,90272
4UrUP 177 8,27698
4Us0Q 180 8,54214
4UtMV 176 9,31531
4VcK0 173 6,31307
4VjZv 173 6,82650
4VkIq 171 6,59437
4Wqc3 182 9,08013
4XENF 167 9,16845
4igSM 193 8,56722
4tBaH 166 6,89959
4uMKJ 181 9,35825
5BKwI 163 9,11578
5TyNS 185 8,63949
5Uprr 204 9,13699
5XUiV 188 6,83531
5jq4H 189 6,53139
5sG5x 184 9,54894
5xcXQ 203 9,41092
63dbz 182 6,32904
64k4u 180 8,21129
671Cw 210 5,88348
6Op8Q 180 9,08522
6S7oQ 181 8,91225
6VM6J 190 5,87706
6W11V 204 9,22718
6W1Ex 215 8,85900
6YFdN 211 8,91690
6YgIX 182 5,98579
6ZlIl 199 8,50346
6a796 204 8,46117
6cOqr 205 7,60593
6h89N 208 8,18860
6k0rb 210 8,58998
6nizJ 214 7,54813
6ommX 205 8,52325
6sIec 190 8,95055
6tHX0 205 8,17358
6uKWh 180 8,21129
6v82J 182 8,54839
6xwKm 169 8,68236
6ybpC 169 8,95848
70FJe 185 8,33681
70I8J 193 8,49024
70jOK 182 8,24584
70jsJ 178 6,83446
70z1u 180 8,77120
71GOh 182 8,25539
71bjR 180 8,21129
722Nf 170 7,76963
72wiT 178 8,89491
76XPl 204 8,17938
76ZqC 204 8,50282
76kl7 205 7,55972
7BHWb 178 5,97522
7BOsF 180 7,61690
7BOtQ 178 8,75650
7BZzk 181 9,39738
7Bad4 199 6,96342
7BpVH 182 8,22708
7Eh1E 180 9,03468
7FKpK 175 6,75073
7FKv7 179 5,79862
7FxNU 186 4,79769
7Ge0Z 179 6,16359
7Hu4v 167 8,63788
7M7BW 190 8,77455
7MYcp 196 8,80079
7OCli 199 8,51603
7Pv0c 180 9,15382
7UOsE 185 8,31966
7UPcr 185 7,69335
7Uqpy 180 9,19243
7VfV6 170 6,36741
7beAX 170 8,44118
7d3u3 205 7,58098
7flMK 203 7,60235
7gMO7 177 6,44539
7gTKe 205 8,19369
7l9BH 178 5,62754
7l9Cy 181 6,65803
7l9Ru 170 6,53014
7l9nF 178 6,95865
7l9oF 170 7,76997
7qYL8 180 8,21129
7qZ2L 205 8,41011
7sSeI 192 7,68727
7sSi0 192 8,22941
7sSl0 192 8,23160
7tXeg 207 8,46568
7tXkY 177 6,12289
7uQjM 185 8,91528
7vJrF 178 8,80356
7wxut 183 9,30003
85RX 178 8,91232
85Rqf 177 9,09747
8B4Ct 173 8,90400
8DLvz 176 9,09702
8E3us 170 8,69454
8Eess 170 6,36741
8Egjs 171 7,64106
8FnJb 175 9,57899
8L1Sz 178 7,74286
8L5ki 180 9,14196
8LCzo 185 8,33687
8h5 192 8,24488
8hlxP 185 6,84281
8kgzp 169 9,43580
8mi3e 203 9,04577
8pk8p 174 9,06782
8s42r 167 6,85532
8wTCd 176 8,87306
8y4y3 180 9,07291
8yyRH 173 6,90585
8yzt7 173 7,74809
A2Cd 185 8,62963
A37u 185 8,66302
A54p 182 7,61844
BIwf 208 8,87390
BPzE 205 7,60320
Bh29 169 8,92670
Bv0a 215 8,81291
C6FW 193 8,50120
CGJ0 192 8,23605
CGTm 181 7,02521
CHKM 197 6,65655
CTMR 190 8,96035
CUrJ 205 8,17358
CUuI 180 7,61372
ClMd 228 8,81246
DTv3 204 8,45234
DU58 205 7,60622
EInL 205 8,15772
ENj2 178 9,32434
ESyJ 180 7,61372
HCcC 203 7,57910
Huvg 180 6,82945
JRYO 205 8,47393
KKZB 180 7,60428
KKci 182 6,33547
MVvp 207 8,86455
MniG 182 7,61366
N3cw 182 6,33547
NBOL 182 8,56554
NUaK 182 8,56554
NbQL 195 8,53189
NcfX 205 7,60320
Nstb 182 8,23392
Nzx2 205 8,40437
O2Y3 178 8,24095
O60q 182 7,61810
O6EN 182 8,26802
OIna 182 8,24584
OP2v 208 8,81691
OP3t 203 7,57910
OiPi 223 9,23247
V0b3 203 7,58234
VPib 207 8,82909
eWPz 181 9,25826
eZI8 187 8,47858
iLr9 179 9,80327
oBmx 208 8,20504
oBoG 205 8,17358
oFDl 203 8,18640
oFFq 227 9,38223
oRAy 205 7,58172
p49s 182 6,33547
p6Uw 205 8,17931
pOUB 180 6,32734
pa9k 185 8,24817
pedL 199 7,84292
qIy3 205 8,74805
qjOc 182 7,61719
sdM5 179 8,88318
wT3u 181 8,55690
wT4W 205 8,48083
xAnF 182 8,25519
xprp 177 6,12289
ydx1 185 8,87615
yqtt 180 8,52325
yttF 205 8,19975
yuhG 182 8,24584
I6R1D5 178 7,74286
A0A8S5R343 124 8,33655
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_11495
wgKr
11 33,5% 179 1.256E-60
2 phalp2_11016
4Prl3
67 27,7% 162 8.910E-45
3 phalp2_36343
kBxJ
714 32,4% 179 1.360E-39
4 phalp2_21852
4t88M
271 28,4% 186 2.293E-38
5 phalp2_40411
4aXVp
16 29,8% 164 8.043E-38
6 phalp2_6329
79LaP
54 26,9% 193 1.664E-35
7 phalp2_21590
2ns10
22 28,9% 166 7.975E-35
8 phalp2_34206
2TNL2
24 28,5% 161 1.073E-31
9 phalp2_1230
jumL
15 28,5% 200 1.073E-31
10 phalp2_31845
4B5i6
56 28,0% 178 5.132E-31

Domains

Domains
Representative sequence (used for alignment): wIlS (199 AA)
Member sequence: AqZb (175 AA)
1 199 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01520

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (wIlS) rather than this protein.
PDB ID
wIlS
Method AlphaFoldv2
Resolution 94.27
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50