Protein

Protein accession
8zvLq [EnVhog]
Representative
42usC
Source
EnVhog (cluster: phalp2_19234)
Protein name
8zvLq
Lysin probability
98%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
mniealreqlkidegvkyeiykdhlgyptfgighlitendpehgepdgkeisedrvnevfatdvakfvseskilfpdldelpdvaqqvivnmafnmgrprlskfknfiagvndrdwtraaeemmdsrwatqvgdrairlrnqiltli
Physico‐chemical
properties
protein length:147 AA
molecular weight:16864,9 Da
isoelectric point:4,81
hydropathy:-0,46
Representative Protein Details
Accession
42usC
Protein name
42usC
Sequence length
220 AA
Molecular weight
24921,53890 Da
Isoelectric point
4,49258
Sequence
MSKYLKGLLPTTGLEFDPSSAPHGYADPTSSGDAFLPDLDFPNGKWGLFGAKSSGPGISEPTDLPDEYYEEVADREELLEQLKEDEGVKYEVYLDHLGYATCGIGHLIKEGDEEFNEEVGTEVSEERVIELFKQDIGIACRDAVNLYGWSGFCEWPEEVQNICINMIFNMGMTRLSKFKNMHKALEQQNWKQAAIEGRDSKWYTQVTNRAERLMSKLEEV
Other Proteins in cluster: phalp2_19234
Total (incl. this protein): 219 Avg length: 163,2 Avg pI: 5,47

Protein ID Length (AA) pI
42usC 220 4,49258
10ND1 154 5,20466
10d2x 157 5,19204
14dGl 146 5,66522
17Bb4 152 5,12753
17uH9 151 5,21642
17v61 202 4,69845
17vhp 166 6,65780
1DvqH 153 4,60643
1EIpd 156 5,09444
1Evef 156 4,99185
1P25I 153 4,72033
1RQcK 157 5,70967
1S3Cw 178 5,43667
1S7uB 201 4,60580
1SPC6 149 4,87198
1SRYS 209 4,53964
1ST4E 149 4,97412
1SYmL 155 5,29173
1Sazf 202 4,50798
1Swc0 149 4,89500
1TAjC 220 4,62854
1TLBK 204 5,44361
1TW37 234 4,69561
1To0E 149 4,97412
1TsTP 157 5,70967
1U1SK 178 5,31759
1U28w 149 4,88306
1UCU9 149 4,87198
1Umbu 154 5,20301
1Uoj4 149 4,87198
1V25x 178 5,44486
1V26X 201 4,42073
1VDcQ 156 4,98179
1VZwp 201 4,59779
1VbSv 148 4,87198
1VcdL 209 4,53964
1VmoI 166 5,47311
1VzQk 149 5,06284
1W0YB 148 5,06085
1W2K9 157 5,50016
1W3YN 149 4,76228
1Wbv9 156 4,98406
1Wbvl 148 4,97565
1Wnsv 149 5,06284
1Wqoh 166 6,84355
1Y9Zg 153 4,77313
1ZgvU 165 6,90840
1ZkGB 153 4,83384
1fLQn 148 4,89500
1fgTo 149 4,81360
1g9bG 157 5,06517
1geCA 211 6,68486
1gg1z 220 4,49258
1haDx 151 5,35642
1qG7r 174 9,66383
1uCOd 147 4,79900
1uWPr 149 5,98159
1vLn9 149 5,72405
1vXxa 157 5,48396
1vt5c 156 4,85447
1xFrw 147 4,81309
1xLW2 216 5,72962
1xLl8 213 6,67860
1y6yD 157 5,48396
227oz 174 5,38381
22v5s 148 4,53890
25Us7 151 4,98298
265sS 149 6,43783
26Nea 149 6,10317
26tTF 149 6,34081
26vF9 142 4,84469
2BAmB 140 5,40211
2M7un 149 6,32484
2MTPG 149 6,32484
2NfqZ 152 5,72115
2RDdC 151 5,49436
2RG3n 151 4,98298
2TQg9 178 5,43667
2TR8s 178 5,43667
2TU7e 178 5,77748
2TUDn 178 5,43667
2U6En 178 5,43667
2YW73 167 8,85307
2ajAR 178 5,77748
2hpXY 174 9,63662
2iN9A 152 4,51616
2iRaf 154 5,21267
2nMS 165 6,90795
2oLuN 148 4,69293
2v3Cp 153 4,91893
2wGGh 171 5,58502
2xi0y 138 7,69716
2yQVW 149 4,89500
2zc8T 151 5,01879
32E7y 165 6,90829
33OHn 172 5,00879
33aqU 141 5,37091
34I0F 149 5,15259
35nzD 148 4,81360
36a2A 146 5,12411
397Jl 153 4,58159
3CoiO 216 5,87376
3GEsW 202 4,65354
3Ht5u 209 5,62276
3I4gM 157 4,35571
3ORY8 154 4,90835
3Rpf2 154 5,00208
3U6so 157 5,33374
3U7sW 151 4,98298
3UTUq 169 5,51056
3Uanm 149 4,96229
3X0zr 158 5,17038
3rGP9 149 5,87354
3rK5U 151 4,98298
3rLK7 223 5,95726
40A0k 165 6,32825
4BjIj 203 6,86254
4GyfS 147 4,60239
4M17U 157 5,26752
4PSP 157 5,19448
4Wvmi 149 6,10362
4tFXv 152 5,72115
4x1Sr 151 5,00578
5DSvE 141 5,03704
5SiH 140 5,84728
5jqNT 150 5,25348
5y8Nm 149 5,85967
5yI3P 149 6,32791
5ydYC 149 6,10697
5zEs5 141 4,89187
6CU81 165 7,67556
6CUEL 167 7,12240
6EGVd 149 5,18777
6Jhmd 149 9,19534
6N2f6 202 4,69845
6NO9a 153 4,65974
6Oz4J 149 4,87198
6VWnH 166 6,52781
6WbcD 178 5,30293
7CV8a 149 4,96229
7ETtM 157 5,48396
7EvZb 146 5,42627
7GROM 154 8,98162
7TGQx 153 5,38319
7WaYi 157 4,35571
7ZviC 153 4,92143
80uOq 157 5,31532
8ABqw 149 4,89500
8APKG 147 4,61779
8AXpH 157 5,70967
8ArLG 206 6,02359
8B2zZ 155 5,29173
8B6cU 141 5,15765
8B9OL 165 8,64729
8BAyP 178 5,29190
8BTL5 148 4,81235
8BmWs 140 6,72652
8CCbS 223 5,87700
8CdUx 149 4,97412
8CgGI 156 4,98179
8D2LG 166 6,59846
8DDM7 178 5,30123
8Dj1W 151 5,12411
8DsTv 216 5,86723
8EoAD 234 4,69561
8F7u9 155 5,26610
8FnDh 202 4,69845
8GQeS 153 4,92143
8GREF 204 5,19857
8Gmyj 152 5,08802
8GoPn 167 5,08421
8GvBp 146 5,28900
8aSKj 157 5,84853
8ctjq 153 4,84049
8d2l9 151 4,81360
8gRkT 204 5,19857
8h2PV 216 5,86723
8hRcK 157 5,50675
8ifob 147 4,97531
8w9u4 151 4,98099
8wIq0 151 5,08802
8wPZk 155 5,09427
8wlyD 137 5,32527
8wrfb 151 4,99458
8ySHa 140 5,40211
8yTeR 152 5,25286
8z4eC 206 6,40254
8z9vm 157 4,35571
8zD28 202 4,65065
8zJnU 141 5,37091
8zOIg 149 5,21972
EcQO 149 6,09936
OK8b 167 8,74979
PN0p 174 5,07972
Wgkn 151 5,12411
Wwub 152 5,08802
Wz7h 152 5,26894
Xfek 157 5,19204
Y1Pz 151 5,08802
YAJ9 202 4,52776
YDmh 152 5,24319
YzLf 157 5,44764
cD8c 167 6,49501
e2YR 149 5,69415
g6KL 156 5,06182
gVwr 156 4,89500
gaoH 202 4,58767
k2bm 142 6,74062
lXYK 175 5,59014
oxz 149 6,90875
sxf1 147 5,05079
vl8P 151 4,98298
xSTn 152 7,09683
xVAM 149 4,97253
yXqt 149 5,97431
zE4B 166 7,85536
zJw3 165 6,12363
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_2924
QDRo
8927 57,0% 149 7.380E-72
2 phalp2_35438
8DSMF
6 41,3% 145 2.048E-47
3 phalp2_11736
3KxWm
1 44,8% 145 4.244E-45
4 phalp2_17008
8jNgs
3526 38,3% 146 5.808E-45
5 phalp2_9780
80F6A
154 36,5% 167 5.808E-45
6 phalp2_32797
2yPO8
5731 37,6% 146 1.200E-42
7 phalp2_27968
RI1z
5083 39,1% 143 3.376E-40
8 phalp2_24334
3Qw2p
463 39,8% 153 3.699E-38
9 phalp2_6928
2KMCh
358 33,5% 158 9.458E-38
10 phalp2_21661
31ima
875 42,3% 144 3.306E-37

Domains

Domains
Disordered region
GH24
Representative sequence (used for alignment): 42usC (220 AA)
Member sequence: 8zvLq (147 AA)
1 220 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF00959

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (42usC) rather than this protein.
PDB ID
42usC
Method AlphaFoldv2
Resolution 76.76
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50