Protein

Protein accession
8zkYn [EnVhog]
Representative
8Gj1t
Source
EnVhog (cluster: phalp2_1208)
Protein name
8zkYn
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
miaecliflatalpqnglmtqdyfneykwcdsiisrdvrehsellieffdepeqlstavkviwcesrgntdairtaegnndsglfqfvswtwnwiaeeydlpmwdewvvmrygrpytgptsksdigfefkkvqhteyyniyfgyllsqdiygrsqwrdwnsskwcwnndvkyitklrreng
Physico‐chemical
properties
protein length:181 AA
molecular weight:21660,0 Da
isoelectric point:4,75
hydropathy:-0,58
Representative Protein Details
Accession
8Gj1t
Protein name
8Gj1t
Sequence length
169 AA
Molecular weight
20017,60530 Da
Isoelectric point
6,58084
Sequence
msyknglmitncvlmyaalmsnfsvgitpeisdleqitycqnnlpantlqystllvnnfkeknietavkvmfcesrmkakayrwqaddsglfqviprtwgwvkskynipywdypignsyaqfipkynievaallveemhtrdnywkpwnsskwcwednnkfeniwrseq
Other Proteins in cluster: phalp2_1208
Total (incl. this protein): 191 Avg length: 173,2 Avg pI: 5,00

Protein ID Length (AA) pI
8Gj1t 169 6,58084
126AL 186 4,72533
14f23 160 4,43926
1A6Br 172 5,02982
1Bl7S 179 4,81656
1C79Z 180 5,41496
1Ecz 179 4,71664
1EuHM 179 4,69026
1F8Et 171 4,86544
1St0P 179 5,61344
1TVFn 179 4,71664
1UBDF 181 4,56493
1UCuy 179 6,09720
1Un5i 181 5,34834
1VjxP 179 4,74494
1W2vl 193 4,58159
1Wkvf 179 4,87937
1WzJ 182 4,87687
1sD6v 179 4,93467
1sHzf 159 4,70629
1uuyA 162 4,98907
1v3MX 186 4,74045
1vLCt 162 4,61978
1vXVJ 178 5,12565
1vnhC 179 5,05102
1w1jh 162 4,98793
1yWXo 161 5,64590
22hHq 179 6,10101
23p7P 166 4,43534
264Rm 179 4,87988
26SZm 185 5,09626
26YTP 183 5,23336
26hBv 164 5,31379
26hCP 163 4,67173
26hX0 160 4,50713
26mM7 168 4,95707
26oTt 164 4,77842
26rUA 164 4,73431
26rlP 162 4,70407
27bAw 161 4,57073
289Nj 179 5,78339
28DrD 162 4,95797
29yqS 179 5,02908
2JOWb 183 4,76620
2Ka1R 179 4,89164
2MhrO 177 4,94973
2OBL9 183 4,97116
2QamL 171 5,43343
2RE3K 179 5,85683
2RFuv 182 4,80599
2RM6R 179 4,40061
2RPsm 179 4,73755
2TDT6 180 5,12406
2h4dP 183 5,23825
2hhFx 176 4,87414
2hiRI 189 5,41405
2hmqC 183 5,39342
2hoTl 179 4,99037
2i9YR 183 5,58701
2iWx6 189 5,83051
2igEE 158 4,36020
2nHQU 179 5,07688
2zRWt 181 4,71664
39Kys 185 4,69293
3DGHl 178 4,95445
3EA5y 163 4,55084
3EbhC 159 4,63394
3FBfd 181 5,18794
3FD80 179 4,82690
3FFPw 164 8,30915
3FzjQ 181 4,77615
3Fzmu 175 4,88130
3GZWX 185 4,78615
3Gg2P 165 4,63064
3H0bT 190 5,01459
3HMWR 178 4,69964
3IVMd 181 5,37165
3IZvL 177 4,82099
3IqUz 164 5,19732
3J9t9 163 4,88698
3Vh4R 158 4,80263
3VoBx 183 5,42116
3Z7oO 186 5,35414
3Z85a 180 5,12480
3ZatD 165 4,76711
3gueQ 133 6,17251
3hGSn 170 8,88511
437Jt 162 4,74994
4UJbp 162 4,50991
4jmBJ 180 5,24933
4suQp 162 4,86362
4tAZ6 183 4,99111
4tiaT 180 5,24933
5A1vH 188 4,71880
5AkEJ 163 4,88698
5AlsT 179 4,78166
5dRhL 171 4,73755
5sdhx 163 4,58534
5temc 186 5,01686
6BhJi 162 4,65258
6CXiy 162 5,13207
6KPF4 179 4,95462
6NB3v 182 4,79110
6Nj81 160 5,31498
6OuMj 163 4,53094
6P9cf 182 4,79110
6X1E7 178 4,99356
7CMg5 162 4,66849
7D8eo 179 4,78126
7D8fg 179 4,71664
7EMeY 173 5,04994
7ERHf 179 5,40678
7SGBv 162 4,98793
7SGvC 165 5,12406
7ST3p 174 5,26485
7ST4K 181 4,97542
7SnNQ 177 4,97792
7SxWW 182 4,90335
7TAkm 162 4,90204
7TBPM 185 5,05119
7TuWr 178 4,79002
7Tuji 164 5,09223
7UxZH 162 4,71806
7V9te 177 4,54231
7VPT0 182 4,85248
7WtgF 180 4,67350
81k5C 160 4,52645
81mnI 183 4,43608
82eGJ 179 5,85228
82itV 173 4,82185
82k4V 163 4,72306
84AeA 163 4,54481
84zTl 180 4,54856
865Kt 178 4,82690
87bwS 178 4,87283
88lB5 178 4,87948
898wf 181 4,75421
8AFu0 181 4,90347
8AS3U 153 4,50116
8BEio 163 4,54481
8BM6q 160 4,87118
8BRzn 164 4,84697
8BVWQ 161 4,52264
8CHjR 182 5,19187
8Ca3S 163 4,43807
8Cdqh 178 4,96275
8DrTG 173 4,62478
8EtAr 165 6,57413
8F05w 162 5,02578
8G6xO 162 4,59165
8GTj4 181 4,75421
8GgTw 163 4,81690
8bVvc 163 4,66895
8c0Di 181 4,69379
8cIjc 177 4,58164
8cL6J 182 4,67350
8cM5l 179 4,77808
8cdHh 163 4,54481
8cq59 183 4,92961
8d9ZJ 160 4,88869
8gByv 180 4,85959
8nNz5 163 4,67173
8p6US 137 4,83867
8p7el 178 4,98060
8pN0N 177 4,98946
8sMeu 162 4,59165
8t1uL 172 5,60162
8tgTe 162 4,57619
8umg5 173 4,62478
8vNS9 160 4,67173
8vTQA 178 4,78001
8vbdt 169 6,58084
8vot0 181 5,74161
8vywq 176 5,22722
8xIlV 164 5,19545
8ydgs 162 4,98793
8zQzC 164 4,65275
8zcR0 164 4,51401
8zt7A 162 4,59165
AoB0 183 5,42650
Aoet 181 4,80729
EfRL 182 6,31648
Psah 164 5,64442
Pul1 188 4,70896
RbQ0 183 4,84691
YCgK 180 4,60290
gGXT 183 5,24655
gID4 162 4,84606
vDYo 179 5,64948
vtVR 182 4,81383
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_17822
8DJo2
441 30,5% 131 7.227E-16
2 phalp2_4553
3ZnDV
172 25,8% 147 4.671E-15
3 phalp2_9000
7SZEo
5 25,6% 113 1.083E-11
4 phalp2_28407
1zZk0
1 24,4% 147 6.898E-11
5 phalp2_15355
1BWpH
3 27,7% 108 9.430E-09
6 phalp2_37315
7YPlR
2 23,0% 130 3.838E-04

Domains

Domains
Unannotated
Representative sequence (used for alignment): 8Gj1t (169 AA)
Member sequence: 8zkYn (181 AA)
1 169 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (8Gj1t) rather than this protein.
PDB ID
8Gj1t
Method AlphaFoldv2
Resolution 92.72
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50