Protein

Protein accession
8zGdd [EnVhog]
Representative
8ATsR
Source
EnVhog (cluster: phalp2_30803)
Protein name
8zGdd
Lysin probability
99%
PhaLP type
endolysin
Probability: 96% (predicted by ML model)
Protein sequence
mtvdvkrvyeeiasdegkilhvylcsenhkttgighkllpsdpeidlpvhdpydevpkedcisegrcyelfqqdvhiaidgcrkiydnweelpqeaqhilvnmcfqlgqgglskfknmntavesqewaimaeqmldsrwarqtpnraerlkeralslasa
Physico‐chemical
properties
protein length:160 AA
molecular weight:18345,5 Da
isoelectric point:4,93
hydropathy:-0,56
Representative Protein Details
Accession
8ATsR
Protein name
8ATsR
Sequence length
168 AA
Molecular weight
19255,74850 Da
Isoelectric point
5,64135
Sequence
mlrtyapinkkrlkeqlkkdegytsepeylkikklpdgtferedhqtvghghkvlpgmkfptfpdggfdtlenvkktvfdklldedmaiaiqdaksligedhppeilegfsnmafqigktklskfvetikfiknnnymeasiemldsdwadqtperatristlfqeak
Other Proteins in cluster: phalp2_30803
Total (incl. this protein): 233 Avg length: 159,2 Avg pI: 5,11

Protein ID Length (AA) pI
8ATsR 168 5,64135
115M8 161 5,67113
11XNN 189 4,98304
1292n 161 4,74631
1A0lX 155 4,92802
1Afal 155 5,22779
1RK5O 160 4,89881
1RKww 160 4,67827
1RMvl 161 4,56317
1RQJA 160 5,00862
1Rmoj 162 5,01731
1RyMO 162 5,01731
1SER8 162 4,80212
1SEXQ 159 4,60955
1SPV1 120 4,68418
1SZU2 162 4,86896
1SkaS 162 4,80212
1SskZ 161 4,64360
1TVwy 159 4,53532
1TYfR 162 4,79587
1Tnwb 160 5,10286
1Tty2 126 4,90045
1U0Rk 162 4,86896
1UFxO 161 5,53199
1UIJA 160 4,70800
1UZLZ 158 4,88562
1VCHC 163 4,60841
1VITH 162 5,11053
1VXjy 162 4,49673
1VowD 162 4,51855
1VrXa 162 4,93217
1W1SS 157 4,73715
1W78G 162 4,80212
1WgdD 162 4,81434
1fdlE 160 4,99702
1g6r6 162 4,94058
1g70H 160 4,81627
1t6IB 154 4,59352
1v1YR 154 4,59352
1xE10 196 5,10280
26Oe9 116 5,00453
2A1au 160 5,43321
2AJh0 160 4,60012
2ANLY 160 4,69265
2ANzH 161 4,59671
2AQ47 178 4,67850
2Aze4 160 4,62819
2BEjg 159 4,70498
2BgPA 150 4,61296
2JYvq 155 4,83202
2KV8b 159 4,58403
2QFrH 136 7,84601
2QspU 178 4,84208
2YLYw 161 4,93149
2iobw 151 5,13497
2jpRu 160 4,68549
2qyf 138 6,74391
2tXve 155 5,06040
2uI1x 154 4,80741
2w9VO 161 4,67702
2x82K 160 4,62819
2xFwV 181 9,55829
2xSgV 160 4,91012
2xXLC 161 4,90705
2yN5l 163 4,90017
2z5pS 161 4,61370
2zTkX 162 4,88596
2zhcx 160 4,60012
368oS 162 4,43693
36dAY 161 4,81065
3BIRy 162 4,86396
3BqHG 162 4,48951
3CFJV 161 4,60546
3CRqx 169 10,23173
3CuYu 160 4,67827
3D09m 160 5,20824
3EXGf 111 6,98548
3Eidp 141 5,06858
3FDDr 163 4,70504
3FdpS 160 5,24268
3GS3i 161 5,81380
3GlFx 161 5,56723
3H4py 160 4,77956
3HciJ 160 4,67219
3Hx2z 160 5,20824
3IKkn 164 9,67337
3JJf6 161 4,95417
3Jphn 161 4,66986
3Jr2I 159 4,67423
3JySs 160 4,92717
3QSl5 162 4,92086
3QUG4 161 4,46592
3RFwj 182 4,77643
3RyKb 161 4,86072
3Sjxm 165 4,92512
3SpAO 138 4,24146
3SpiO 161 5,00811
3Ulj1 163 4,70504
3UmV7 162 4,94246
3Vuyu 162 4,55754
3jdRs 160 4,70578
3jlhH 141 4,94933
3jorw 160 4,70578
3rE8G 154 4,99168
3rIuY 153 8,81413
40BF0 160 4,83605
40yXj 160 4,59187
42qsF 162 4,79752
438xq 155 5,01248
43bvi 155 4,91989
48wTw 159 4,59852
4PdJ3 155 4,80741
4QOKo 159 4,84856
4TOSU 160 5,10070
4TTYs 160 5,11161
4Uoku 152 9,72320
4UrzI 146 9,66402
4VHnx 155 4,92290
4Xlt 160 4,74568
4Xm6Q 160 4,52765
4dFfN 160 4,67145
4dHfC 158 4,59307
4t5G5 155 4,78047
5skL5 160 4,49241
6AUAG 161 4,73033
6AUOK 161 4,73414
6AUol 165 4,94070
6Bmt6 154 4,59352
6N21c 161 4,73414
6NGL2 160 4,92387
7DAkM 162 4,80212
7DBaQ 162 4,80212
7Dsqe 162 4,92813
7EA9N 161 4,62740
7EozS 162 4,65428
7Hmqw 147 6,74857
7SveX 162 4,80212
7TY26 160 5,20824
7YFKj 162 4,80212
81x1X 162 4,48655
84IQW 160 5,10070
84Yj9 163 4,70504
8538x 160 4,92660
85Mar 154 9,38636
88ESf 162 4,92035
89YKJ 159 4,50798
8AMXe 161 4,77473
8AWlP 160 4,65218
8Awyx 141 4,94871
8BQsT 161 4,91392
8Bf6S 161 5,24405
8BsqH 161 4,62740
8BzsT 161 5,81380
8C51S 160 4,87681
8C7u5 162 4,92813
8CM1l 161 4,50514
8COwT 161 4,49786
8Cbhh 160 5,10070
8Cnjn 161 4,79706
8Cz24 160 5,20824
8D1OS 159 4,58466
8Difl 163 4,90017
8DsBt 160 4,67827
8DsWA 160 4,81627
8EA3N 162 4,65428
8ETg0 160 4,93933
8EfBY 161 5,56723
8Em5h 141 5,06767
8Er8y 160 5,00862
8FLJB 161 4,59671
8Fh8G 161 4,49786
8G4z3 160 5,24103
8G5OU 160 7,63509
8G7Tt 161 4,46592
8G9Jo 161 4,56317
8GMMv 160 5,10286
8Gqzi 166 5,24723
8GtfW 160 4,77956
8aaw4 153 8,81413
8bVbG 166 5,24723
8c0I6 153 8,81413
8c3dp 160 4,81627
8g0HF 160 4,64934
8g4PL 159 4,93143
8gfeg 161 5,17493
8ijW5 160 4,93456
8ksIm 159 4,57272
8ofyL 160 4,93933
8qE6T 162 4,95542
8tF6l 160 4,93933
8tk8X 162 4,80212
8uDD9 162 5,34596
8uURF 153 8,81413
8uZCn 160 4,49241
8ubQv 162 4,88596
8wCFW 163 4,65048
8wHhr 147 6,74857
8wTlQ 160 4,66559
8wq2z 160 5,20824
8wucN 161 4,69265
8wv2O 161 4,73414
8x5qV 160 4,60012
8x7mB 162 4,77956
8xJ5Y 162 4,93217
8xMa5 162 4,80212
8xWlk 161 4,77649
8xYik 159 5,38279
8xtTV 161 4,95417
8y3xo 160 4,57539
8yKT8 162 4,86396
8yddD 160 4,82963
8ygFV 159 4,70498
8ytGh 153 8,81413
8zIV6 161 4,57539
8zYru 159 4,65121
8zZ9O 161 4,56459
8zmsO 160 4,93933
9ivM 155 4,69401
El7o 162 4,62740
IdhL 160 4,93984
OHst 160 5,13793
VFJZ 158 4,46825
VGJi 159 4,76933
WicY 161 4,73414
WsVU 160 4,57539
WxF5 163 4,65048
YNo0 160 4,93984
ZfCP 159 5,12105
e0tB 161 4,61370
iko4 155 4,91591
pciK 161 4,49980
rvaB 161 5,81380
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_2924
QDRo
8927 31,0% 161 5.892E-41
2 phalp2_35438
8DSMF
6 27,1% 162 3.202E-38
3 phalp2_19234
42usC
219 32,5% 163 1.545E-37
4 phalp2_21661
31ima
875 32,0% 159 6.844E-33
5 phalp2_9780
80F6A
154 28,8% 163 5.041E-30
6 phalp2_24334
3Qw2p
463 27,6% 170 1.052E-27
7 phalp2_11886
2cyBF
52 30,1% 159 9.467E-27
8 phalp2_27968
RI1z
5083 29,8% 154 1.774E-26
9 phalp2_17008
8jNgs
3526 27,1% 162 3.322E-26
10 phalp2_4536
3Rwtq
17 37,4% 163 1.166E-25

Domains

Domains
Unannotated
Representative sequence (used for alignment): 8ATsR (168 AA)
Member sequence: 8zGdd (160 AA)
1 168 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (8ATsR) rather than this protein.
PDB ID
8ATsR
Method AlphaFoldv2
Resolution 90.53
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50