Protein
- Protein accession
- 8zCkf [EnVhog]
- Representative
- NQqI
- Source
- EnVhog (cluster: phalp2_2920)
- Protein name
- 8zCkf
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
mfifskpdrdidrvfihcsasslkahdsvqvvgswhikngwsdigynyyitfdgdvhcgrdveiipaaqrghntgtiaiclsglreddftkeqfeslrnlceqiddripdvtfhghcevsdkecpvfdyrsvlgldhlgamsikreeyattpvldearnelieicqdlldlkaktnllnervqflgsliedl
- Physico‐chemical
properties -
protein length: 192 AA molecular weight: 21820,3 Da isoelectric point: 4,79 hydropathy: -0,28
Representative Protein Details
- Accession
- NQqI
- Protein name
- NQqI
- Sequence length
- 235 AA
- Molecular weight
- 26823,12420 Da
- Isoelectric point
- 6,06179
- Sequence
-
MSLFTKPKREITKVFLHCSASNRPTHDNVEVIRSWHKQRGWSDIGYHFFIRADGTIEKGRDLESKPAAQKGHNTGSIAICLHGLYPQDFTVNQYDSVYGLCQAIDLAYDDRRISFHGHCEVSVKPCPVFDYRTVLNLDNLGLMFMDNKDDAFRPPLQLFNRGLEVVRLQRQLNLWLDEAKGEADPERLVVDGIFGQNTQIAVMQFQGFNELESDGIVGPRTRLKLPIVEPQEAAY
Other Proteins in cluster: phalp2_2920
| Total (incl. this protein): 114 | Avg length: 230,7 | Avg pI: 7,10 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| NQqI | 235 | 6,06179 |
| 17ovd | 148 | 6,47205 |
| 1BZh | 192 | 4,96792 |
| 1BdIp | 192 | 4,96792 |
| 1C5Lz | 241 | 6,55714 |
| 1C7Hc | 192 | 4,96792 |
| 1CF6h | 192 | 4,96792 |
| 1HN0U | 152 | 5,54910 |
| 1HN4I | 152 | 5,70990 |
| 1HOs2 | 137 | 5,86649 |
| 1ahia | 199 | 4,78876 |
| 1s4O | 199 | 4,50537 |
| 2Kbhd | 192 | 4,96792 |
| 2QQDk | 192 | 5,21904 |
| 2QQX1 | 241 | 6,85822 |
| 2UcrV | 345 | 8,33204 |
| 2V6RN | 156 | 6,69617 |
| 2aTkP | 157 | 9,44792 |
| 2jAR0 | 342 | 8,89401 |
| 2jifz | 274 | 7,73854 |
| 2jrSp | 224 | 8,24913 |
| 2mKHJ | 190 | 6,10027 |
| 33aDG | 221 | 6,29466 |
| 33tFa | 162 | 9,09567 |
| 3ENWV | 165 | 6,64615 |
| 3T1PZ | 238 | 5,97391 |
| 3Vp9c | 204 | 4,59045 |
| 3XZe | 194 | 8,55142 |
| 3aUGW | 242 | 5,45094 |
| 3bKd9 | 243 | 6,54617 |
| 3iRNE | 226 | 10,53505 |
| 47UBP | 226 | 9,42755 |
| 4BlDR | 143 | 9,84763 |
| 4DkI | 188 | 8,68223 |
| 4FwAv | 264 | 6,04093 |
| 4Nc4P | 219 | 8,54762 |
| 4OJxn | 308 | 4,63229 |
| 4OPjf | 240 | 8,77803 |
| 4QCwb | 347 | 9,31363 |
| 4WkaP | 262 | 5,97983 |
| 4Wu9Y | 258 | 5,03471 |
| 4X32L | 238 | 6,91898 |
| 4dZmx | 346 | 8,88292 |
| 4hXaF | 234 | 8,97492 |
| 4uG4R | 238 | 8,44189 |
| 4yJuN | 223 | 6,10169 |
| 5dIeY | 195 | 5,03357 |
| 5dS8b | 236 | 5,76901 |
| 5mbT3 | 164 | 9,92273 |
| 5qYRn | 248 | 9,18476 |
| 6AQQv | 346 | 8,80298 |
| 6CVh2 | 177 | 9,25233 |
| 6MOx5 | 162 | 9,09599 |
| 6P31j | 168 | 6,15858 |
| 6TuqV | 269 | 5,68153 |
| 6Tx1E | 267 | 5,77475 |
| 6VVFH | 221 | 6,78802 |
| 6VVwz | 220 | 6,49285 |
| 71PDZ | 340 | 9,12797 |
| 7Bxk2 | 164 | 9,79670 |
| 7CRx4 | 196 | 5,49510 |
| 7KZGE | 393 | 8,51565 |
| 7VgkU | 238 | 5,96010 |
| 7e5rl | 343 | 7,69790 |
| 7e6L6 | 353 | 6,26448 |
| 7hv6a | 352 | 9,44347 |
| 7jTdX | 162 | 9,33368 |
| 7jX5z | 247 | 5,90895 |
| 7m6NF | 348 | 9,22963 |
| 7nHWh | 346 | 9,56474 |
| 7okYW | 164 | 9,44870 |
| 7pood | 345 | 8,27221 |
| 7w723 | 162 | 9,49872 |
| 7xQxX | 349 | 9,14582 |
| 7y0Hk | 337 | 8,33404 |
| 80YmM | 141 | 5,32049 |
| 82I5U | 203 | 4,67031 |
| 84Wup | 143 | 9,83712 |
| 8AiGk | 238 | 5,96010 |
| 8BZvE | 199 | 4,68054 |
| 8CGgJ | 238 | 6,85554 |
| 8Dzql | 238 | 6,85554 |
| 8E5iP | 248 | 6,25436 |
| 8FcrQ | 248 | 5,68654 |
| 8FnCJ | 248 | 6,13062 |
| 8Fvu8 | 165 | 6,64615 |
| 8Ges1 | 239 | 6,79188 |
| 8dL5V | 232 | 8,79170 |
| 8kFuE | 210 | 9,25104 |
| 8ktgF | 241 | 6,85822 |
| 8tCc | 248 | 5,68790 |
| 8wXwF | 203 | 4,67031 |
| 8yTFS | 231 | 6,24356 |
| 8zNmx | 199 | 4,80309 |
| CzK6 | 238 | 6,78592 |
| P56Y | 227 | 8,70415 |
| PaKR | 223 | 6,74658 |
| Ri6L | 172 | 5,88405 |
| TtgA | 221 | 6,58681 |
| VA5G | 267 | 8,86938 |
| ViVN | 248 | 5,97647 |
| XZOz | 221 | 6,40242 |
| dgcr | 162 | 8,96879 |
| dn8D | 199 | 4,77183 |
| dvQq | 162 | 9,09567 |
| dwCa | 351 | 8,93637 |
| gQiK | 348 | 9,35941 |
| hh40 | 266 | 6,04030 |
| inyU | 247 | 4,89107 |
| ist4 | 131 | 8,72078 |
| rxOn | 232 | 5,51863 |
| tX58 | 241 | 6,55765 |
| A0A6J5MBI6 | 150 | 7,71836 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_30941
13o5z
|
7 | 60,0% | 150 | 1.293E-64 |
| 2 |
phalp2_38947
3NmsY
|
2 | 49,0% | 151 | 1.613E-54 |
| 3 |
phalp2_25618
48uUY
|
31 | 31,5% | 244 | 8.011E-40 |
| 4 |
phalp2_36521
1qwup
|
277 | 33,1% | 226 | 8.011E-40 |
| 5 |
phalp2_28171
8yYQh
|
287 | 34,7% | 161 | 1.376E-33 |
| 6 |
phalp2_19675
4Bope
|
30 | 30,0% | 223 | 4.230E-32 |
| 7 |
phalp2_35819
4CbZx
|
312 | 30,0% | 193 | 2.545E-28 |
| 8 |
phalp2_22939
3bu4t
|
1 | 27,4% | 226 | 6.735E-26 |
| 9 |
phalp2_9794
8qYns
|
5 | 36,6% | 153 | 2.753E-24 |
| 10 |
phalp2_13210
2JwXt
|
44 | 25,9% | 239 | 1.755E-23 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(NQqI)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50