Protein

Protein accession
8yMY0 [EnVhog]
Representative
1EEQn
Source
EnVhog (cluster: phalp2_22580)
Protein name
8yMY0
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
mstyiseqsewkeewknfvldefkcsccsevkvdaamidllqearnelgplsitsayrcpshnasvsstgeagphttghaldiavknsqhrkqlidwfttkvtglgvaksfihidnlteeqgfdmrpnawky
Physico‐chemical
properties
protein length:132 AA
molecular weight:14854,5 Da
isoelectric point:5,47
hydropathy:-0,46
Representative Protein Details
Accession
1EEQn
Protein name
1EEQn
Sequence length
132 AA
Molecular weight
15013,96560 Da
Isoelectric point
8,40889
Sequence
MSTYIREQSEWMEKWKNFKLDEFRCRCGCGHAEVHSDLLDLLQTARENLGPIQITSAYRCPSHNDKVSSTGLAGPHTTAMAVDIHVSNSQHRKSLIDWFAKRVTGLGIAKTFLHIDIIPPSQLAHRPNAWIY
Other Proteins in cluster: phalp2_22580
Total (incl. this protein): 196 Avg length: 132,8 Avg pI: 7,02

Protein ID Length (AA) pI
1EEQn 132 8,40889
14j0L 126 8,25642
14vBL 127 9,23498
16W6t 144 8,51565
16vCh 135 9,25162
17f9v 155 9,84473
1A5U5 138 7,00247
1KgvS 143 9,04551
1RrT0 132 6,07310
1ePY 133 8,26989
1fmPz 130 5,89627
1ftpZ 147 6,40140
1g9eo 135 7,68267
1npj 133 7,68733
1s4kb 138 5,18101
1saAL 135 7,72262
1u4Je 137 6,30824
1uSXZ 147 6,16927
1vJvi 132 5,90162
1vY5K 136 6,26061
1vxAt 131 6,27374
1wyc4 133 6,49234
1xzRU 133 6,16836
1yU6I 133 6,93972
1zu2k 133 8,65709
27Gy0 128 6,27596
28qJ1 133 7,65601
2AzSM 133 8,26989
2FN8o 131 6,35434
2IqJW 133 5,28315
2JOP5 128 6,57391
2JP6I 132 7,63628
2KCf2 128 6,03041
2Kgda 138 7,77697
2KhNM 133 8,26764
2LhXq 123 8,32978
2MKMd 131 5,80272
2MNMp 135 7,72262
2MWqv 135 8,71266
2Mcku 131 5,79703
2MxZp 131 6,02371
2Og5p 133 7,63458
2OpgA 138 8,45298
2REin 131 6,98156
2RIdP 128 5,42184
2UGB5 132 9,41408
2XvQg 123 8,48277
2ZL32 134 6,35542
2Zf8s 136 6,00779
2a34N 138 7,04664
2dTKM 130 5,70461
2imsO 138 7,00247
2saaO 131 8,52061
2ux2t 95 6,02319
2w9vM 131 5,92384
2wtMO 131 5,92384
2xbXg 132 7,68329
2yPAR 131 6,01751
2zhBG 135 8,62099
31EYS 123 8,37336
353BC 132 6,03803
36enE 129 4,71777
37STa 172 9,51123
3CGcV 128 5,65141
3CwKv 135 8,36311
3FSRp 132 6,35974
3IFB6 133 6,39248
3IJ3j 132 5,47350
3Je0m 132 5,13764
3OROi 136 6,49132
3Ppin 138 8,24410
3S2x8 132 8,19891
3WXYt 128 6,56817
3cs8k 136 6,26300
3gx7r 132 7,08114
3gx9E 131 6,49598
3oPtL 132 5,50704
42gRh 130 7,03516
43lh9 132 6,02621
455OA 130 6,69105
4C1ck 132 9,48344
4DDRE 135 9,76665
4DKzF 135 8,76262
4DM7 133 7,63458
4JnYi 136 5,71359
4Njag 144 6,40453
4PdI2 131 6,27374
4SNmM 129 7,69858
4TcX 128 5,58940
4c24B 142 8,86668
4dHZj 132 5,80851
4hHoi 150 9,68226
4kJja 129 8,80969
4qZVK 144 6,95075
4so9L 133 6,93972
4xGGK 135 8,72033
4zXMU 140 8,35351
5Bh2h 135 5,81556
5cx8Y 132 9,45811
5mv6d 97 8,95113
5pzgn 122 6,17961
5rQKZ 128 5,79885
5rto8 131 6,42232
6ATPa 136 6,56981
6BhBC 132 5,89997
6BhBc 131 5,89627
6BhgJ 129 5,89997
6BjgR 122 7,07432
6BpQw 133 6,49314
6CRLY 131 6,12528
6CYUi 133 6,49115
6Ip55 131 5,80203
6Kxz5 117 9,35805
6McKk 132 9,64507
6Mf08 139 8,22831
6U2kH 107 7,01680
6Uol 135 6,57266
6X3DB 138 5,63953
7D2DJ 132 6,42016
7D2E2 129 6,17183
7D2EZ 133 6,02382
7D32O 135 8,35157
7Da2O 131 6,02342
7DanN 132 7,08068
7EDnf 132 7,03578
7EOxN 133 6,94865
7Etxf 128 6,02774
7FUWy 151 8,99394
7GVe0 129 6,26652
7Hqaw 133 6,93972
7J1ef 131 5,73485
7KuMC 128 7,75337
7LorZ 139 8,92947
7T0TX 131 5,65738
7TxEK 127 9,00174
7V1Op 128 5,56501
7Vgua 131 6,27385
8090C 116 10,89659
80Ock 139 8,65690
81hk6 138 9,03062
82kDG 138 8,46588
83QMf 136 5,45412
83kAm 129 4,76779
83sWd 131 5,58940
844GW 136 4,77876
89PPS 132 6,35246
8AZr3 136 6,03360
8AppW 133 6,49234
8Bd9L 131 7,69858
8CUle 132 6,35974
8DtoS 133 6,28858
8E79O 132 6,63598
8EwhD 137 8,71163
8GcmA 146 6,06668
8GoLF 131 6,27385
8aSPR 131 5,79703
8acut 132 6,64047
8axRF 135 8,71266
8b5Ia 143 9,48344
8c2Wb 132 5,28156
8cngE 147 6,89772
8e4sS 131 5,80823
8edff 136 6,03360
8hHop 133 7,69557
8hmW8 131 6,12880
8hvON 137 8,71163
8igvL 138 5,26303
8jJwb 133 6,03536
8mkwI 123 9,50330
8oqPN 124 9,36740
8t9ch 109 7,60747
8uU6c 132 5,40621
8ud1L 132 6,02621
8ud5t 135 7,71819
8uduG 131 6,17132
8upmP 131 5,63964
8ve0E 136 5,84915
8vx1v 132 7,07489
8wOVZ 132 6,03240
8waCF 147 6,89772
8wza8 132 6,64047
8xkKR 140 9,71024
8xyUv 131 6,12880
8zYMa 136 6,38475
Aep4 132 6,69310
aOUY 126 7,78657
ih6C 135 8,73587
irRy 135 6,28431
lanO 132 6,93654
pGgx 138 5,43974
r6oQ 151 5,74929
t8mN 132 6,12499
tfVC 128 6,03041
xYQ 133 8,24468
A0A7T3U6U7 131 5,65977
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_39422
7D36k
12 46,3% 97 4.726E-35
2 phalp2_29133
79Li3
3905 40,1% 107 2.865E-33
3 phalp2_38763
1dS3s
1408 40,3% 119 3.929E-33
4 phalp2_11545
XXz6
1240 40,2% 134 7.387E-33
5 phalp2_6873
2aTQG
108 39,3% 127 2.380E-31
6 phalp2_9004
4UQIh
3 38,1% 131 2.169E-30
7 phalp2_3181
8qBIB
378 30,9% 113 1.089E-26
8 phalp2_1834
3nSHh
7 34,7% 118 3.847E-26
9 phalp2_30902
HOls
632 37,2% 102 1.359E-25
10 phalp2_14040
85wjf
1353 32,7% 119 1.359E-25

Domains

Domains
Representative sequence (used for alignment): 1EEQn (132 AA)
Member sequence: 8yMY0 (132 AA)
1 132 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF08291

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1EEQn) rather than this protein.
PDB ID
1EEQn
Method AlphaFoldv2
Resolution 97.42
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50