Protein

Protein accession
8xjBs [EnVhog]
Representative
6AJjn
Source
EnVhog (cluster: phalp2_9165)
Protein name
8xjBs
Lysin probability
98%
PhaLP type
endolysin
Probability: 94% (predicted by ML model)
Protein sequence
mkkiitiamlfigcvdtpigdnqtiisvdstshidddytysdwdrlvdaviyvesrgndsavgdngkavgclqihpimvrevnrlvstpytledrysraksiemfnliseeydcceeytfmqyaeivsrrwnggpigdkkrstikywnkvtqql
Physico‐chemical
properties
protein length:154 AA
molecular weight:17649,8 Da
isoelectric point:4,90
hydropathy:-0,35
Representative Protein Details
Accession
6AJjn
Protein name
6AJjn
Sequence length
192 AA
Molecular weight
21677,91040 Da
Isoelectric point
9,67911
Sequence
MKKIENIALAFLCVFMFNALTTSAQSEDSILILKPGSSTKDVLAYTANHSKFSNDVADTQYPVMGIDTVGDDIPDSVAKFNWTPIINGIIQVESKGNPKAVSGLSVGVMQITPVLVSDCNRILRRRKCRKRFSLRDRWSVSKSKEMFLIFQSFYNPLNDLERAIRSWNGGVHYSIKRTQRYFEKVMAAMKAL
Other Proteins in cluster: phalp2_9165
Total (incl. this protein): 149 Avg length: 164,4 Avg pI: 8,13

Protein ID Length (AA) pI
6AJjn 192 9,67911
1255r 177 9,44618
14aI9 162 9,07755
14bb3 143 9,45869
15ULX 162 9,12732
1P4fr 170 5,65067
1PAVF 142 9,69426
1V2Fd 159 9,70908
1iBH9 161 6,64626
1s8DA 173 6,66525
1t0Lj 142 8,40631
1tPou 173 6,66525
1tsUa 173 7,77845
1ubf7 173 6,39276
1xAIv 172 9,49150
1z4bn 171 10,03755
28Hte 140 9,09734
29iZN 179 8,34957
29mcI 180 6,91346
2Gbjj 165 5,57041
2I4bJ 184 6,84435
2IxgV 165 5,57041
2JMlh 162 8,81420
2Jg9Y 165 5,32811
2N02H 166 6,21372
2QWJR 162 8,86861
2YMA3 179 8,89801
2nFkr 170 4,93944
2nG1l 163 8,70402
2oYzR 180 8,37278
2vwA3 134 7,75411
2wX2U 145 8,78938
2xien 171 9,81268
2xisD 170 9,68233
2yinm 172 9,53779
35uDb 160 9,19095
38CM1 184 6,00319
39G4s 173 7,79998
3J3Li 149 9,48570
3QuC3 150 9,86387
3Qv3W 169 9,74686
3S703 147 5,97295
3Xdez 144 9,58079
3Xocx 151 9,72456
3Z3KL 171 7,77993
3hDz6 180 9,80953
3mQFm 151 9,70863
3mTEO 174 6,92563
4Bt7e 161 9,29874
4DHyT 145 6,84293
4JLzv 162 5,61441
4MdyX 117 9,02881
4QD7s 148 9,00896
4Vgvn 172 7,68471
4hMnI 172 9,27502
4hXak 184 8,22889
4imhd 180 6,44744
4ixnS 172 9,18373
4jvX7 155 9,21029
4tgLf 162 9,51304
4x9Tw 174 5,83392
6AZUq 174 6,19712
6B1Fk 162 8,89665
6B1rr 174 5,84796
6B95U 137 4,94098
6Bcq4 172 9,61657
6Bor6 172 9,61657
6FXYM 127 9,06337
6HAkn 208 9,37346
6JP0Q 177 7,78535
6NYVa 196 4,89437
6NfVW 164 5,17260
6OF9M 147 8,67875
6QVao 173 8,43854
6V1JX 141 7,95400
6X0KY 157 5,64311
6sK2H 146 9,96941
6z6N 193 8,97872
7COpQ 172 4,84566
7EUzH 138 8,83264
7Ec8g 164 9,54230
7Eujc 169 7,06716
7FzNJ 172 9,95561
7GCyh 147 9,37785
7GrVl 142 9,67911
7HCPr 178 9,40447
7LuRB 177 8,86951
7Lzf6 205 5,29236
7SENW 177 6,86180
7SRRP 158 9,86065
7SXaO 171 8,47671
7TO3 164 5,39313
7TyPO 173 5,26502
7UuSj 147 9,37785
7Uy2M 177 8,96834
7V85w 171 8,47671
7VH3t 172 9,62450
7VePv 164 9,46971
7Xz5a 142 8,98446
7ZLDP 164 8,66566
828nF 164 8,89652
82OhZ 172 9,49150
83fdi 157 8,33778
83fy5 184 7,66533
85HoI 173 5,26502
86wS3 184 5,74065
87bdi 140 7,73905
88yOm 157 9,84189
8AGih 158 9,81849
8C6xA 171 8,47671
8CKDw 174 9,07729
8CoVu 157 8,31792
8Cqpt 161 10,04155
8Cza2 173 5,26502
8Di5m 195 9,44090
8Dic7 160 9,77123
8Dkd9 162 4,64968
8F2Xg 157 10,40960
8F6T1 162 4,57897
8FQe8 177 7,80333
8FXqS 173 8,94152
8Fg4W 177 9,19456
8GJdl 162 9,67446
8bbVD 142 9,43696
8biY4 154 5,52977
8cuIo 184 6,10226
8nrDD 174 6,19712
8wZe9 133 9,86755
8xUys 161 10,05412
8xWht 168 9,72146
8xngg 179 9,40105
8xySx 179 9,40105
8y1ZF 168 9,55752
8yEWR 161 10,09016
8ynTg 173 6,01768
8yrTl 179 9,40105
8yxuP 142 9,08219
AxZm 162 8,99252
HfOl 145 7,95690
PoCM 156 8,77191
RvNn 138 6,22816
WS4G 177 8,92444
Wzlz 192 9,62682
X8zG 126 9,35116
dSqq 173 5,83892
k7o5 195 6,95422
ppO 155 8,54420
vG0G 103 4,84646
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_46
7Exor
250 35,0% 140 6.527E-51
2 phalp2_5196
3O9Fp
630 29,1% 151 2.847E-28
3 phalp2_4079
1lhaR
1 35,7% 123 2.974E-23
4 phalp2_2751
7yxpI
42 31,7% 126 1.588E-18
5 phalp2_11846
8fsBr
1 26,0% 119 2.695E-13
6 phalp2_21013
4IiQ
26 23,1% 138 9.200E-13
7 phalp2_1124
18Iz
3 24,6% 138 4.911E-11
8 phalp2_10835
4edjb
3 25,0% 124 1.663E-10
9 phalp2_28345
1din1
3 17,6% 130 5.277E-08

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 6AJjn (192 AA)
Member sequence: 8xjBs (154 AA)
1 192 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (6AJjn) rather than this protein.
PDB ID
6AJjn
Method AlphaFoldv2
Resolution 77.98
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50