Protein

Protein accession
8wnfx [EnVhog]
Representative
2jrH4
Source
EnVhog (cluster: phalp2_11894)
Protein name
8wnfx
Lysin probability
98%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
msnlrtetkyivihssesspkedfdvkdidtqhrkdglfscafhkiikrdgtiqdgrdiqiagahiadgslklsnknsigiclvggkttdgqpdcnytfkqytalvnlvkklkqdysgveivghrdvadsvsphfdvsellr
Physico‐chemical
properties
protein length:142 AA
molecular weight:15751,6 Da
isoelectric point:6,58
hydropathy:-0,48
Representative Protein Details
Accession
2jrH4
Protein name
2jrH4
Sequence length
144 AA
Molecular weight
16673,83150 Da
Isoelectric point
9,26573
Sequence
MTYRNTRKETKYIIVSDSSTKPEENIGYKELEKQDRMDGWFSCRYHKIIKRDGKIEDGRDIDQSSVILNDHETAFKNKVSISVCLVGGKSHKGKPDCNYTFKQFKSLKKVLNELKKMYPIAKQVGHRDVADSASPSFDLSEFMR
Other Proteins in cluster: phalp2_11894
Total (incl. this protein): 329 Avg length: 144,9 Avg pI: 7,65

Protein ID Length (AA) pI
2jrH4 144 9,26573
10q5l 139 9,15910
114BA 162 6,64837
115Nw 147 6,59346
12qRe 144 8,88614
13L1o 140 6,36997
1DFC 141 6,94961
1EHls 149 5,95504
1Ibf4 163 6,37156
1KA1t 146 9,09715
1KC8q 147 8,94243
1Lyka 142 7,05170
1OH2o 144 9,24330
1PTVs 141 6,94745
1Q0Ao 149 6,29488
1QtcI 129 5,82863
1T1gD 143 5,27889
1TSAC 149 5,82318
1Tpi5 143 5,13940
1UUPZ 143 5,69921
1UdNb 146 6,96354
1UkoN 161 6,36696
1Vgrk 144 8,92773
1Vy3g 143 5,90935
1WbwS 143 6,19661
1b0Pd 149 7,04789
1fMvB 142 6,57766
1fhQ4 144 9,37559
1ga0Y 163 6,64581
1gfS6 145 5,44207
1hVZn 141 6,64137
1klK2 153 9,29810
1nlr 145 8,80711
1pf0G 143 8,84044
1rYJ5 141 6,94745
1rj6B 146 8,68249
1seqH 141 6,50070
1sqe4 144 8,55052
1t0rL 144 8,56580
1tB2N 145 9,29997
1vCgm 147 9,67666
1vWUS 144 9,29926
1wteT 147 5,85563
1yPF7 145 8,90645
1zW7k 161 6,37150
22wre 149 5,85563
25H4u 111 7,74479
26DKc 141 6,50377
26Tvj 141 9,27205
26gRX 142 6,04110
26v1U 144 8,86680
272lr 141 6,94984
273XE 141 6,57953
27bv5 141 6,50263
28isR 141 6,94745
28qdV 143 5,92276
2AXMj 147 7,71228
2AvF0 143 6,50996
2Fnit 147 8,79125
2HUOZ 134 8,99290
2HdvB 149 6,06497
2K5AT 149 6,06190
2K8Mm 144 9,12029
2N5bL 144 9,27366
2N8nm 144 7,80411
2NOqj 144 9,05131
2QPOV 141 6,12153
2R7Dr 143 6,18575
2TBwF 141 7,69517
2TSzD 152 8,40772
2TUTE 141 7,00725
2Tgxt 138 7,04306
2UF9d 149 5,85563
2UIRd 149 6,29710
2Ua3H 148 7,79831
2aluC 141 7,00725
2cyh4 143 7,75792
2dMDR 144 8,51745
2eEov 144 8,90652
2eUPn 143 6,50263
2jwEa 141 6,94853
2jwZc 144 8,92773
2rriy 144 5,56513
2tYqw 156 8,71962
2vz2O 141 6,94745
2w1We 141 6,50070
2x8lt 144 8,90645
2z9v7 144 8,90645
32nxO 141 6,13568
3519C 143 7,00730
35NLW 148 8,94965
36eYy 144 9,32343
39ETd 143 7,00730
3AFe 141 6,94745
3Axu1 148 7,79167
3BLfa 144 7,80411
3Cbni 126 6,20298
3Cyon 141 7,00725
3EEob 144 8,92773
3FWjz 146 7,62696
3Gr0M 144 7,80411
3Guw8 161 6,64700
3H5y 141 6,94745
3IC6A 144 8,88595
3IFsj 141 6,50070
3IXdy 144 9,09741
3JLMO 144 8,90645
3JjF8 144 8,53344
3JmVk 156 9,09767
3Jngm 144 5,56513
3L4Ch 143 9,32724
3M2C3 161 6,37042
3N7f0 135 8,42984
3OVFN 153 5,54541
3RMrK 141 6,57823
3U8yT 144 9,17296
3UXSi 143 7,75690
3Z8nD 142 6,28300
3dwAw 144 6,07998
3ot7n 146 6,64052
3rxjZ 140 6,06457
40QQc 157 9,54108
42FJ6 158 6,14079
42KSO 115 7,74507
43efh 141 6,28329
44YuR 135 6,58050
4998X 129 9,91815
4KJmU 143 6,50883
4OTiT 144 9,14441
4PWS4 141 7,75252
4Ppi0 149 6,29585
4QaME 144 9,14441
4REs0 143 7,75127
4RycB 149 9,48132
4W8L2 156 7,67721
4XSjN 148 9,29848
4XVZg 146 9,40376
4XZ7G 141 8,56612
4Xs6T 143 7,77105
4XvjO 146 9,40415
4Xwq0 146 9,29939
4YhmH 147 8,98156
4Ym4k 147 8,86339
4ZeAh 164 7,63486
4jmit 143 7,77871
4jvLS 141 7,73086
4lh2W 146 9,81230
4mpwV 140 8,49437
4o3Uq 148 9,36502
4qzJZ 147 9,29971
4r2p7 144 6,28300
4sC9M 119 5,29213
4t4jn 144 8,88653
4tMm9 142 8,82503
4teGC 141 6,12153
4tlyo 143 6,94984
4v4zd 143 6,49450
4vR4H 143 5,41826
5AfXu 153 5,29844
5dIV 143 5,44526
5jtwC 143 7,77942
5kSbZ 150 8,35338
5lsPN 146 10,11839
5oPVV 160 6,64638
5rcfD 132 8,71891
5tbfg 143 6,50263
5tcyc 144 9,37559
65CK 138 9,17290
6FOuB 141 6,11522
6JHjF 144 9,12010
6N4ZP 141 7,71063
6NMVg 144 8,88595
6NNCV 141 6,90721
6OGIx 144 9,29990
6OQ3A 143 7,75639
6OmMZ 141 8,53015
6P2Yj 147 5,85978
6RHJ0 141 7,00725
6VL3a 149 9,34123
6W2nz 149 9,48132
71Cqp 210 9,43915
75SPD 149 7,74434
7A2xH 146 9,43625
7AUFp 139 7,05278
7CBC7 141 6,18263
7CWnH 145 8,84908
7D9Lu 144 8,42713
7Pzwz 153 9,12081
7UdH 141 8,88479
7Vf6G 149 6,06054
7WeGl 141 7,75690
7ZOqN 144 8,88614
7Zewx 143 9,21809
7ZqXO 144 9,21829
7dy9k 147 7,73064
7e2pG 149 8,38168
7eQUw 149 6,64501
7eeBN 149 7,04732
7eo0J 148 7,80353
7iW01 149 7,04732
7jyql 146 9,27031
7sXTI 147 8,42894
7sa3f 139 7,05198
7zO5f 151 8,37678
80OfI 149 9,71134
80wg5 133 8,55523
81BMr 144 8,88434
87CuO 136 9,12287
88lqv 144 8,92837
8A0gK 144 5,80812
8ATi1 183 7,74161
8AVTQ 149 5,67761
8Ag1v 149 6,19820
8AzAf 148 9,08058
8BCDD 153 5,93151
8BCaL 141 8,41881
8BDMq 151 9,13293
8BH6D 142 6,04110
8BIrr 152 9,23730
8BO77 144 8,33829
8BiGA 136 6,58334
8BxCz 149 6,09072
8CDS4 141 6,94745
8CDfY 153 5,33158
8CWVx 161 6,64638
8D3qZ 147 7,00674
8D8vW 138 6,13835
8DHeg 144 8,53344
8DJ9h 144 8,88595
8E1iQ 144 9,17013
8EHei 146 8,66798
8EO43 145 8,80711
8EPIx 148 8,94204
8Ech7 173 7,00259
8FaXg 144 5,56513
8GrGf 144 8,92773
8GxbD 141 6,50070
8IsOq 150 9,09715
8IsPm 146 9,37578
8LIT4 150 8,68088
8LpDV 151 8,72053
8M4Yp 144 8,88595
8MPr6 141 8,82522
8My6t 143 9,11681
8a0Rr 144 8,90645
8aH8S 144 8,42713
8bZFY 149 6,58567
8c4yz 144 8,88440
8j2QG 144 6,64615
8oTXz 146 9,27031
8oU42 140 9,07285
8phIU 141 8,58192
8tFbE 149 6,95802
8tvDt 143 9,35734
8vWOQ 161 6,64581
8w0bo 144 8,84856
8w2uU 161 6,37156
8w4C6 147 6,95802
8wE2h 141 8,51668
8wIFJ 144 8,51745
8wLrm 143 7,00639
8wNaq 142 5,66278
8wc0P 153 5,78475
8wmK1 144 8,42713
8wmrT 141 7,75127
8wq0b 161 6,36696
8xGNR 142 5,18721
8xIIX 160 6,64837
8xShs 153 5,53813
8xXGj 152 9,25664
8xiu1 144 7,80411
8xlDH 161 6,37156
8y3f0 144 8,90645
8yMPw 140 6,06457
8yQ2g 144 8,88595
8yQ7Z 144 8,90645
8yaxd 161 6,64513
8yfWQ 141 7,75639
8ys9w 141 7,75690
8ytMr 145 8,84908
8z8AR 144 8,86680
8zTkv 107 9,16632
8zfK0 144 9,17013
8zla3 143 9,32724
8zqIo 148 9,23737
ABow 144 9,24330
CH9s 152 8,92902
Eq6a 144 5,34448
I8uG 144 5,56519
IbeL 144 6,07992
IhDy 134 8,77629
IhKn 142 6,03774
PqqY 141 6,94745
Pt6A 141 6,94745
Qlkj 144 8,84856
VTY8 105 10,00055
VXJN 144 5,56519
Vdbc 142 5,35369
Vhev 141 7,88959
WU4n 144 8,84856
WU7d 141 6,63961
Wsk7 153 5,78475
XtoJ 141 5,94788
YCii 162 7,04988
cBIA 144 6,07992
dQgJ 141 6,99986
dnMd 153 5,93151
gWJM 144 8,79047
guqo 145 6,47580
lW8p 141 7,75718
p91z 143 7,75718
pEjU 149 6,06497
phmg 143 7,75718
piyN 143 8,41881
qi3 143 8,65696
r0wi 141 7,75718
rKIe 141 7,71131
rrEI 143 5,53097
sLvX 126 7,74524
su1i 149 5,85109
t1IE 135 8,90523
ulH2 141 7,75718
vD3x 141 6,50070
w2kR 145 9,07613
wCVv 141 7,04840
woMf 149 6,58630
xxYq 146 9,92608
zDen 141 7,00730
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_3887
6RreM
7260 38,1% 139 3.052E-62
2 phalp2_36193
72BPm
409 37,5% 144 2.537E-60
3 phalp2_28564
7Z48s
97 39,7% 141 1.022E-57
4 phalp2_24237
2YSsA
71 37,4% 147 6.793E-57
5 phalp2_12381
8yxE3
11 42,0% 138 1.597E-55
6 phalp2_5171
285Oe
13 35,9% 139 4.116E-55
7 phalp2_2237
4n15b
512 35,7% 154 8.036E-52
8 phalp2_23766
13ajC
287 39,3% 132 4.192E-45
9 phalp2_12261
71VXz
7 33,9% 156 5.235E-44
10 phalp2_28171
8yYQh
287 30,7% 140 1.119E-41

Domains

Domains
Unannotated
Representative sequence (used for alignment): 2jrH4 (144 AA)
Member sequence: 8wnfx (142 AA)
1 144 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (2jrH4) rather than this protein.
PDB ID
2jrH4
Method AlphaFoldv2
Resolution 89.82
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50