Protein

Protein accession
8r8Mw [EnVhog]
Representative
85nHe
Source
EnVhog (cluster: phalp2_31222)
Protein name
8r8Mw
Lysin probability
99%
PhaLP type
endolysin
Probability: 96% (predicted by ML model)
Protein sequence
MAVIIGSARQDERGHYSGGKAGDQTGREVSTQNFYNNSKGWNILRAKDNKVAEKLAEAMKIACGNNNIGYDQSGRYGVIKHGIKAKVKTECDCSSLVRACIIYATGKDVGDFNTENERSVILKSGLFDDIGSYKNGKTLYNGDILVTRTKGHTVIVVSGAKKGKGKYYPKYTGSSGSIVEALKAVGEDDVSKEHRAEIAKKNGFSNFKFTSEKNSKMLSLLKNGKLKK
Physico‐chemical
properties
protein length:228 AA
molecular weight:24804,9 Da
isoelectric point:9,60
hydropathy:-0,61
Representative Protein Details
Accession
85nHe
Protein name
85nHe
Sequence length
251 AA
Molecular weight
27329,62140 Da
Isoelectric point
9,16039
Sequence
MTVKIGSARISENNTINGVKGDSTGKEVAIENFYMHELGWYCLRPKDSTKAKAIAENMIRACNNDNIGYSQKERSAIWYVGTGTTEPTNCDCSSLGSECIREAGIPVENFTTANAVSKINATGAFEKKFEVTNANQLKVGDCLVTKKKGHFAIVVETSNSNVNTTSTNTSSNSVVGIDSAKSFDKTLAKTYTTTANVNIRSGASVAKRIIKTVPKDTKVKCYGYYTVTLGTKWYYVKCDNITGFISSKYCK
Other Proteins in cluster: phalp2_31222
Total (incl. this protein): 226 Avg length: 237,9 Avg pI: 9,20

Protein ID Length (AA) pI
85nHe 251 9,16039
19c0x 255 8,23559
19hy3 235 9,44953
1Hrpd 322 9,80282
1cLWR 234 8,95106
1cvcC 261 9,20030
1gB5i 238 9,01437
1kBjX 261 9,39867
21QKF 278 7,51334
21hHx 237 9,51626
21iBW 255 6,21423
21kbf 261 9,34632
21nQd 277 8,74999
21trL 238 9,15240
21uTc 255 8,76494
21xIw 237 9,48074
235ID 237 9,51626
235OZ 225 8,91464
23EGA 277 8,74277
23EPU 248 9,46965
23FHN 241 9,42059
23JSw 255 6,51928
23McU 237 9,49731
23di9 255 8,76494
23zID 238 9,20868
24BZk 237 9,44941
24GBm 257 7,77315
24HIc 256 6,09305
24kQe 238 9,39061
2VkQq 240 9,30068
2fXku 238 9,30029
38Pw4 237 9,46481
3TFPe 237 9,47152
3TORo 258 9,32015
3TP1M 241 9,46101
3TPmM 236 9,46642
3TQb2 255 6,09953
3VFZy 234 9,31544
3VKjx 238 9,30029
3WE7m 262 9,58833
3WOmr 270 9,45991
3ZBwf 240 9,38636
3ZMij 248 8,90033
3bUQh 288 9,17954
3dQ4r 259 9,32027
3dVwA 355 8,01685
3fIZh 357 8,56264
3fUZF 243 9,22873
3gQKZ 242 9,48544
3gUkh 282 8,90432
3gYYM 206 9,21281
3oQGM 174 9,73468
3s5XN 229 9,38661
3sFYE 229 9,46836
3sWSu 229 9,40557
3sXS5 229 9,37462
3st3v 229 9,36321
3t4u2 229 9,50478
3t8Jr 229 9,41814
3thzV 229 9,36321
3uPxY 229 9,47687
3ukjT 229 9,36779
3vyne 229 9,35199
3yHzr 229 9,36321
40iYY 240 9,32350
40k6s 282 9,07117
41eBw 237 9,48074
41iyF 255 6,42919
41n0R 233 9,54462
41rME 200 8,21954
4L5OK 256 8,52299
4LbRs 252 7,99177
4Vwjj 229 9,36308
4k4NH 358 9,21248
4k97T 238 9,46649
4kbzo 243 9,63198
4y9CE 235 8,91728
4ybdt 249 9,46971
4yhIS 234 8,61022
4yhzx 238 9,11997
4yrV9 233 9,18399
4ytIB 235 8,79273
4yufR 250 8,52912
4yvcx 247 9,20288
4ywb1 259 9,31254
5JZAS 229 9,34419
5KFlb 229 9,30016
5L5Pu 229 9,36779
5L74v 229 9,30042
5LdUp 229 9,31138
5NFtX 229 9,31125
5NPP9 229 9,41775
5NfC7 234 9,54701
5Ng0p 229 9,30035
5Np8e 232 8,91748
5Nrf6 229 9,32131
5OPV6 229 9,40557
5Oj7P 229 9,43696
5OwxA 229 9,38229
5P9jp 229 9,47719
5PLID 229 9,31138
5PWN1 229 9,30068
5PyJa 229 9,41794
5RMND 229 9,36992
5Sf1n 229 9,37443
5TZCw 241 9,48299
5TsVH 229 9,37443
5U6NB 229 9,42188
5U7qM 229 9,43058
5UJZh 241 9,47261
5UTfq 229 9,30035
5UTn3 229 9,38603
5Uotc 229 9,30035
5VjvK 229 9,16935
5VqKZ 229 9,43058
5XGka 229 9,43703
5Xd1v 229 9,36321
5XdEh 229 9,36308
5YF41 229 9,50459
5YOmy 229 9,18973
5Z3zF 229 9,34419
5ZATe 229 9,35199
5ZV1V 229 9,52844
5jLuf 250 9,40118
5r1G 252 9,36727
5roI 245 8,85320
60Ljd 229 9,41027
60eCx 229 9,30061
61iV2 228 9,58285
62fEL 240 9,57737
62moB 232 9,31247
63ENw 229 9,37443
63kUd 229 9,37443
64134 229 9,31138
64Bnt 229 9,08793
64HqK 229 9,38068
64OyT 229 9,30042
64cq8 229 9,31125
64iVr 229 9,38068
65jyZ 229 9,25400
65kCJ 229 9,32272
667dU 241 9,51484
66LHn 229 9,32434
66b2j 229 9,25400
66jm 260 8,90394
67XLS 229 9,48983
67t4u 229 9,37475
67y9g 229 9,41421
68eTp 229 9,35212
68edM 229 9,19882
692xx 229 9,23827
6a0IM 182 9,75105
6agsc 229 9,36779
6bWAY 234 9,59439
6dGVM 229 9,49273
6dNx4 229 9,36779
6dhZx 229 9,36308
6eNPV 229 9,17922
6ef79 229 9,37475
6egRr 229 9,28972
6ezXu 229 9,41027
6fOOW 229 9,41001
6foD6 229 9,33220
6gbPP 229 9,27843
6hcLS 229 9,43380
6hh8Z 229 9,37488
6iaZq 229 9,32253
6jb1j 229 9,22718
6klgS 229 9,36308
6lYJI 229 9,38661
6lgBT 229 9,39873
6mbsJ 229 9,44876
6miKE 229 9,40557
6n7Ob 229 9,37475
6nty2 229 9,34400
6o12c 229 9,21893
6o9pt 229 9,36779
6olbD 229 9,31138
6p5a8 229 9,36779
6pamJ 241 9,40473
6peIW 229 9,32279
6pfAr 229 9,42175
6prnf 229 9,46301
6qEe8 229 9,43664
6qf5a 229 9,31222
6qg4n 229 9,35573
6qruj 229 9,43380
6r5aT 229 9,17948
6rAF9 229 9,07575
6rVYK 229 9,23827
6rvky 234 9,61264
6sj8f 234 9,54701
6tibI 229 9,30055
6uAeA 229 9,39383
6uyWF 229 9,24343
6vJOT 229 9,22692
6vJQc 229 9,31138
6vfZT 229 9,33227
6wOtw 229 9,38661
6wjB0 229 9,39222
71isK 241 9,39319
7DIUf 286 8,89014
7DPbu 236 9,16265
7DQau 196 9,77149
7DTHV 237 8,68771
7Llb7 237 9,53238
7OJWZ 229 9,25413
7Uj2m 229 9,43393
7XiYI 229 9,43664
84wX3 229 9,30035
85Oee 239 9,42362
87yjq 255 8,25455
8dWsO 245 8,91129
8eSUB 229 9,41775
8fMZp 229 9,34400
8lQKR 228 9,22286
8lzUh 229 9,22692
8m8j2 245 8,91129
8nE5e 251 9,16039
8pwCA 239 9,51645
8qNc6 280 8,93417
8smXX 280 8,81362
8tLoo 243 9,68884
8tQfn 220 9,15704
DNyq 229 9,43696
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_8699
8bteS
39 53,3% 165 2.193E-75
2 phalp2_22835
2mtEo
6 41,0% 219 6.338E-70
3 phalp2_19270
84Tjp
100 50,0% 164 9.670E-68
4 phalp2_2158
3Px71
215 32,9% 346 2.427E-52
5 phalp2_11747
41dax
7 37,8% 206 6.214E-52
6 phalp2_14958
q7W9
544 39,7% 181 3.185E-46
7 phalp2_18916
23Hlc
105 32,2% 279 2.967E-40
8 phalp2_10720
3dNKh
35 29,1% 271 1.340E-36
9 phalp2_15414
23rlq
22 35,1% 182 6.496E-29
10 phalp2_18083
3TFqE
6 30,2% 195 5.023E-25

Domains

Domains
Unannotated
Unannotated
Representative sequence (used for alignment): 85nHe (251 AA)
Member sequence: 8r8Mw (228 AA)
1 251 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (85nHe) rather than this protein.
PDB ID
85nHe
Method AlphaFoldv2
Resolution 87.41
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50