Protein

Protein accession
8r7JH [EnVhog]
Representative
6iLgH
Source
EnVhog (cluster: phalp2_39580)
Protein name
8r7JH
Lysin probability
99%
PhaLP type
endolysin
Probability: 97% (predicted by ML model)
Protein sequence
MAMTFDEFVKKYKGKGINFDKLYGVQCFDLANQYNRDVIGCGMFTGLYARQIYEDFDKQAVKDYFTRIKNTPSFVPKKGDIVVWGGSLNGGIGHVAIATGEGNKRYFYSYDQNWLGKNDPCTRVYHNYNHVLGVLRPKNQSVINPPTLETKGYKKGASTDGSYALKQLLILDGAKLDDNAIIGKGTVSAINARLKAWGYSTNGIAGKIVIKKLREKIKK
Physico‐chemical
properties
protein length:219 AA
molecular weight:24455,8 Da
isoelectric point:9,61
hydropathy:-0,43
Representative Protein Details
Accession
6iLgH
Protein name
6iLgH
Sequence length
216 AA
Molecular weight
23855,97450 Da
Isoelectric point
9,65873
Sequence
MKYNEFVKKFLGKKTDYDKVCGVQCVDLAKQYLYSVFGIKAGAWGNAKDYWLSFNSHSALKSKFTKIKNTPDFVPKKGDIVVWSGDISSNNDCGHIAIATGEGNTSYFYSYDQNWGSKEMKKVKHSYKAVYGVLRPKDQSKIKTTKKVTTTKATVDANGGLTMRSKIGTTAGVVTTIPNGATVDVINKNCGSKNGHGWAKVKYKSYTGYVASEYLK
Other Proteins in cluster: phalp2_39580
Total (incl. this protein): 177 Avg length: 221,2 Avg pI: 9,48

Protein ID Length (AA) pI
6iLgH 216 9,65873
1KLZD 193 10,05689
1Lqnu 194 10,24727
1odeQ 237 9,75299
1p0DI 193 9,94001
23bxr 214 5,86484
23pPa 223 9,13158
2lVxI 212 8,46562
2mgvu 219 9,68968
2yBP 222 8,99639
2yNd 219 9,61554
3GOY2 222 8,98781
3JbPu 222 8,99639
3VIPZ 225 9,45527
3WDBP 211 9,47010
3kODr 219 9,70541
3l2Xl 217 9,56854
3lPX4 219 9,65796
3lY92 222 9,56887
3lgfp 219 9,68968
3nIL6 206 9,57338
3nO15 210 9,32795
3p8Vn 217 9,69013
3pdhB 212 9,51187
3rcZP 237 9,72320
3sAjK 219 9,72178
3tJbl 217 9,76685
3tg4Y 219 9,67272
3trLS 237 9,75060
3w4SM 219 9,65815
3xImX 205 8,16242
3xo3v 212 9,60858
3xsZ2 219 9,67317
3y8Uu 224 9,79869
3yi14 222 9,65815
3yv0M 219 9,65815
3zInK 237 9,72301
419UN 202 8,81774
41qg8 181 5,82920
4L5GB 186 8,80305
4L5GY 188 8,86242
4k7qT 203 8,97053
4yf8j 233 9,18573
5K9x6 237 9,77142
5KG8L 222 9,15962
5KGZQ 219 9,68968
5L1Rs 217 9,69787
5L43V 222 8,99639
5LBo5 219 9,69097
5MAJz 219 9,71985
5MCTq 222 8,92631
5Mkqn 219 9,64345
5N36T 219 9,75924
5N5oA 219 9,70496
5N7zo 237 9,71037
5NEI7 219 9,61709
5NlYn 217 9,71959
5OZ6h 222 8,91735
5OrZP 226 9,67492
5P4VT 222 8,90026
5PCYO 237 9,71605
5PdzZ 222 9,62405
5Pi6S 213 9,21229
5Py24 237 9,76182
5QWP2 222 8,89227
5QXux 216 9,65570
5QasA 216 9,50717
5QptO 224 9,78354
5R2OQ 237 9,71012
5SPfq 219 9,62927
5Siog 237 9,74815
5SvUs 222 8,99632
5TCm0 219 9,67492
5TNgC 219 9,65770
5TgC2 217 9,59543
5UhlP 233 9,27966
5V3bb 219 9,62966
5WHhx 237 9,69071
5WPD9 222 9,07852
5WPgD 222 9,02456
5WQKf 219 9,75924
5WVAO 237 9,73655
5Y6mo 237 9,76137
5YMIl 222 9,06956
5Z9ac 219 9,65815
5ZhfH 237 9,74776
60WH4 217 9,64307
60ZUy 224 9,71933
61dXW 219 9,71933
61nyj 219 9,56164
61wWh 222 9,04377
64FBN 222 9,01444
65PfG 218 9,72404
666am 237 9,77594
67At4 237 9,80798
68slr 219 9,57325
694h1 219 9,65861
695qj 237 9,73906
699Mb 237 9,68381
6aNUX 237 9,72301
6bPB3 237 9,74815
6bkVM 222 8,88421
6cDvt 219 9,54495
6cdkY 215 9,82216
6cwUg 216 9,71811
6dT1h 219 9,73494
6dfNP 219 9,67472
6diqY 222 8,99645
6dyKT 237 9,76156
6fBre 217 9,69052
6fXvJ 217 9,76279
6fdMl 219 9,73468
6fwpJ 237 9,73455
6fzNG 219 9,68826
6h5wB 237 9,68323
6hJU9 219 9,60916
6hzGI 219 9,71933
6ihvG 219 9,66093
6iuKR 237 9,69716
6jXQY 222 8,89208
6jrcv 237 9,72282
6k3Rh 237 9,65570
6k8cj 237 9,73700
6lDb1 237 9,72410
6li8V 219 9,65815
6nYYE 237 9,67666
6o8XB 237 9,70986
6oh0r 216 9,74512
6one2 237 9,80327
6onea 237 9,77568
6ox6w 237 9,73655
6p7Jn 222 9,60896
6q5ZS 236 9,05583
6qJLY 219 9,61006
6qK93 219 9,75034
6qR0T 200 9,71766
6rFrH 213 9,63933
6rYbN 224 9,78380
6rjlp 217 9,71933
6s6CM 219 9,58137
6sPFc 237 9,73655
6ss0L 237 9,74796
6uAy3 217 9,67517
6uLNR 222 9,02372
6v1RR 237 9,73655
6vSRG 237 9,69696
6vqdp 237 9,68362
6vtEQ 217 9,69013
6w3Lb 219 9,58157
76kW5 186 8,92541
7W5Pp 210 9,67214
7WSuq 207 9,64300
7WUsd 216 9,56558
7YDVJ 217 9,73468
7YE4o 221 9,32324
7tBvV 219 9,67537
7uokd 226 9,70496
80js8 192 8,99129
80qEE 217 9,66112
84cr6 213 7,73570
866I4 217 9,44625
86W6W 219 9,75060
88V63 219 9,71959
8IO10 237 9,72913
8djRW 194 10,31354
8f7Jp 222 8,98781
8jCUd 263 9,54276
8miQg 171 7,70989
8nEwr 237 9,77142
8ng27 224 9,79869
8qlSL 219 9,68949
8rOcG 212 9,48480
8s4Yz 224 9,80824
gpHS 228 7,57382
oguy 221 9,45579
t2h5 190 9,53805
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_36270
68r1
10 46,3% 222 7.112E-67
2 phalp2_10799
3WA57
47 55,1% 154 2.612E-57
3 phalp2_40070
41p3c
4 36,7% 223 2.637E-42
4 phalp2_30855
o6ig
43 34,7% 239 4.937E-42
5 phalp2_11601
1gImm
4 38,2% 178 9.243E-42
6 phalp2_15913
4FuWg
22 37,1% 148 6.665E-39
7 phalp2_24452
4BMZo
66 40,8% 142 5.968E-38
8 phalp2_11577
18WTO
29 42,0% 145 1.668E-35
9 phalp2_30026
2tAM9
32 39,8% 153 2.036E-34
10 phalp2_37199
1X3cR
12 40,5% 138 4.635E-33

Domains

Domains
Representative sequence (used for alignment): 6iLgH (216 AA)
Member sequence: 8r7JH (219 AA)
1 216 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF05257, PF08239

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (6iLgH) rather than this protein.
PDB ID
6iLgH
Method AlphaFoldv2
Resolution 95.47
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50