Protein
- Protein accession
- 8qoCU [EnVhog]
- Representative
- 38zLG
- Source
- EnVhog (cluster: phalp2_1804)
- Protein name
- 8qoCU
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 98% (predicted by ML model) - Protein sequence
-
MEQVAPNFSIKEFVSKEIYDAYGDRSTWFVNPQCWIFAQFCKDFFTDYFKEQSSKVVSVSIVINDWSWGGKFNWRCHRTVDYINKHGGAKLSQHIGGAANAIDFNVVVKFEDGRKEYIGCNIIREIIMAHEKEFMEAGLTTLEDGHYAKSWVHADFRFTGLEHIFIVKPRKK
- Physico‐chemical
properties -
protein length: 172 AA molecular weight: 20031,6 Da isoelectric point: 7,05 hydropathy: -0,32
Representative Protein Details
- Accession
- 38zLG
- Protein name
- 38zLG
- Sequence length
- 186 AA
- Molecular weight
- 22485,64840 Da
- Isoelectric point
- 9,11095
- Sequence
-
MMGTEMEIKKLVDMQKELDKALIYGRIEPLDYIIESRNVQYWMCEIKREKRMKYFKVQELVSEEIYNKYSESYILSRFFDNRMLQTLDSIREHFGALTVNNWSYGGNRTESGLRVQGMKNYNFTSLHSWGRAFDIVSKKYTAEEMRKEILKNQYKFPFIRRMEKDVPWLHIDNYTTNNKYIVLFGA
Other Proteins in cluster: phalp2_1804
| Total (incl. this protein): 170 | Avg length: 148,3 | Avg pI: 8,02 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 38zLG | 186 | 9,11095 |
| 134ID | 154 | 9,26399 |
| 19dOD | 148 | 9,05209 |
| 1BEFm | 150 | 7,14082 |
| 1BJc9 | 162 | 7,78264 |
| 1BOdJ | 152 | 9,47745 |
| 1G4r5 | 149 | 7,65828 |
| 1G5or | 150 | 8,19550 |
| 1HXuz | 188 | 8,22412 |
| 1HXxn | 149 | 5,53409 |
| 1LPTa | 137 | 7,06096 |
| 1MvLH | 151 | 7,00719 |
| 1NxNt | 144 | 8,24217 |
| 1dSbP | 147 | 6,98565 |
| 1l3gM | 135 | 8,36124 |
| 1l8mw | 138 | 7,82603 |
| 1lc0Y | 135 | 9,14350 |
| 1ldD6 | 135 | 9,16935 |
| 1ojfz | 152 | 5,02584 |
| 1qIVd | 150 | 5,53807 |
| 1raTA | 146 | 5,29992 |
| 28Bih | 136 | 8,80350 |
| 298GM | 136 | 9,52058 |
| 2FReX | 136 | 9,36173 |
| 2Fa9r | 141 | 9,00148 |
| 2J5wj | 136 | 9,07175 |
| 2NNE3 | 136 | 9,42452 |
| 2Ofml | 136 | 9,27225 |
| 2Vw0a | 175 | 7,83918 |
| 2l5i3 | 154 | 9,07710 |
| 2lOxk | 160 | 6,64717 |
| 36tOO | 142 | 8,84192 |
| 3LhWe | 152 | 8,35157 |
| 3OimA | 162 | 5,10343 |
| 3Y5fD | 141 | 7,74007 |
| 3Y6oN | 138 | 7,66834 |
| 3bLDW | 139 | 9,42413 |
| 3bYw9 | 150 | 8,29155 |
| 3eWws | 155 | 8,70389 |
| 3gjw4 | 148 | 8,60519 |
| 3hbsB | 138 | 8,83277 |
| 3is3R | 146 | 9,08432 |
| 3kIWs | 156 | 8,42043 |
| 3l7kd | 143 | 8,75566 |
| 3lAQP | 142 | 8,43712 |
| 3n8rG | 140 | 7,67357 |
| 3nsZC | 149 | 6,74920 |
| 401ws | 150 | 9,20694 |
| 40dxL | 153 | 9,22344 |
| 41vVk | 148 | 9,07542 |
| 44Pyk | 145 | 6,95535 |
| 45Dvu | 161 | 6,65166 |
| 4AM2E | 162 | 8,76946 |
| 4BiFZ | 137 | 5,63390 |
| 4CAAo | 144 | 7,70722 |
| 4GKsM | 145 | 8,82477 |
| 4H6GK | 135 | 6,57743 |
| 4HXCN | 148 | 7,02180 |
| 4HqRj | 140 | 6,42351 |
| 4Hr7V | 141 | 8,64561 |
| 4HxHO | 138 | 5,19613 |
| 4LgGR | 140 | 8,77545 |
| 4M9UO | 138 | 6,94200 |
| 4OZkV | 143 | 6,08373 |
| 4Qi6K | 138 | 6,94200 |
| 4RutN | 146 | 8,39502 |
| 4UhyO | 152 | 9,13267 |
| 4YxJY | 190 | 6,70117 |
| 4dLvu | 137 | 5,93856 |
| 4hP4l | 141 | 6,73169 |
| 4jj4r | 144 | 9,07252 |
| 4yH7D | 146 | 6,14108 |
| 4yIAV | 144 | 7,70722 |
| 4yzYx | 174 | 8,45504 |
| 5I62H | 138 | 5,58389 |
| 5XuLo | 151 | 6,58806 |
| 5XzOj | 171 | 7,54523 |
| 61lZH | 152 | 8,26415 |
| 6Cwve | 139 | 4,86675 |
| 6KYe4 | 136 | 7,05937 |
| 6QEZl | 138 | 5,49203 |
| 6RohN | 154 | 8,86990 |
| 6SOVG | 142 | 7,85620 |
| 6U2zz | 144 | 8,45131 |
| 6UJKq | 155 | 9,15111 |
| 6cKdD | 152 | 6,58118 |
| 6g3re | 152 | 6,99764 |
| 6mFS2 | 171 | 7,54523 |
| 6oY9s | 151 | 6,29807 |
| 6w577 | 147 | 9,03017 |
| 6w7vr | 147 | 9,09728 |
| 72dif | 138 | 6,49530 |
| 7FYml | 138 | 8,79002 |
| 7FwCy | 143 | 6,19348 |
| 7MmfE | 156 | 8,42043 |
| 7NahC | 156 | 8,42043 |
| 7Nqk2 | 155 | 8,92579 |
| 7NrZ7 | 156 | 8,42043 |
| 7P6Rr | 156 | 8,42043 |
| 7US7T | 156 | 8,42043 |
| 7VUjD | 156 | 8,42043 |
| 7WEo6 | 156 | 8,42043 |
| 7WX7w | 156 | 8,42043 |
| 7X59H | 152 | 9,11166 |
| 7XgBy | 152 | 9,11166 |
| 7Yn4J | 143 | 8,95384 |
| 7ZDk0 | 156 | 8,42043 |
| 7ZLTn | 156 | 8,42043 |
| 7Zgaz | 156 | 8,42043 |
| 7dHqk | 152 | 7,00259 |
| 80PpW | 143 | 8,69261 |
| 81XDp | 147 | 8,49037 |
| 81x9H | 143 | 8,69261 |
| 82Y8L | 156 | 8,42043 |
| 83Uw1 | 143 | 8,78486 |
| 84wAe | 143 | 8,96899 |
| 851li | 147 | 8,87003 |
| 86XjK | 147 | 8,24926 |
| 86fxG | 143 | 8,69261 |
| 86kTp | 147 | 8,55536 |
| 87NgW | 156 | 8,42043 |
| 87RrS | 147 | 8,56445 |
| 87XFV | 143 | 8,69261 |
| 87Xwo | 156 | 8,42043 |
| 88nBL | 156 | 8,42043 |
| 890rQ | 143 | 8,69261 |
| 896xL | 143 | 8,75566 |
| 89vId | 143 | 8,69261 |
| 8R8b | 148 | 8,88673 |
| 8brpF | 148 | 9,39873 |
| 8cg51 | 155 | 8,92560 |
| 8eSdQ | 156 | 8,42043 |
| 8fB0z | 143 | 8,69261 |
| 8fNgu | 156 | 8,42043 |
| 8hKzm | 144 | 7,81500 |
| 8iFCR | 143 | 7,76099 |
| 8jBcy | 147 | 9,11204 |
| 8lpjK | 147 | 7,63447 |
| 8mNWO | 156 | 8,42043 |
| 8mcIf | 143 | 8,69261 |
| 8mdKf | 143 | 8,69261 |
| 8mgdg | 156 | 8,73065 |
| 8n3Qy | 155 | 7,75661 |
| 8ndx2 | 156 | 8,42043 |
| 8ngwj | 156 | 8,42043 |
| 8oCz4 | 156 | 8,42043 |
| 8oMXX | 142 | 8,43712 |
| 8oO6h | 156 | 8,42043 |
| 8piB7 | 156 | 8,42043 |
| 8pyqz | 156 | 8,42043 |
| 8pzpC | 147 | 8,87003 |
| 8rKFf | 142 | 9,12996 |
| 8rOff | 146 | 5,40263 |
| 8ry8y | 156 | 8,42043 |
| 8s3ae | 139 | 6,73340 |
| 8sfSa | 143 | 8,69261 |
| 8sfzz | 156 | 8,42043 |
| 8u7Hk | 143 | 8,69261 |
| 8uWTy | 143 | 8,69261 |
| 8uWZo | 156 | 8,42043 |
| 8vrme | 143 | 8,69261 |
| 8xK6V | 136 | 9,36173 |
| 8xpBz | 136 | 9,52058 |
| 8y6Wi | 139 | 4,86675 |
| UDB3 | 144 | 6,36218 |
| Xpni | 136 | 9,36173 |
| d1Vr | 142 | 5,23518 |
| ixmz | 136 | 7,94336 |
| usE2 | 136 | 6,90488 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_1968
4BR1x
|
969 | 46,8% | 143 | 1.107E-58 |
| 2 |
phalp2_34764
3iKHD
|
290 | 44,2% | 131 | 6.946E-51 |
| 3 |
phalp2_15854
4n48g
|
114 | 46,2% | 134 | 8.137E-40 |
| 4 |
phalp2_10855
4iQ7K
|
18 | 36,7% | 147 | 2.874E-33 |
| 5 |
phalp2_7525
4Yxu6
|
7 | 30,7% | 169 | 2.805E-27 |
| 6 |
phalp2_18225
4Pqnf
|
1 | 27,0% | 159 | 2.508E-26 |
| 7 |
phalp2_17599
6zH5y
|
2 | 23,7% | 135 | 3.318E-23 |
| 8 |
phalp2_6141
5y5Uw
|
17 | 36,4% | 140 | 2.788E-19 |
| 9 |
phalp2_20168
45b2m
|
1 | 27,9% | 136 | 6.233E-18 |
| 10 |
phalp2_31809
4kTVa
|
1 | 25,5% | 141 | 3.509E-16 |
Domains
Domains
1
186 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(38zLG)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50