Protein
- Protein accession
- 8nrSc [EnVhog]
- Representative
- 1cZKK
- Source
- EnVhog (cluster: phalp2_22499)
- Protein name
- 8nrSc
- Lysin probability
- 94%
- PhaLP type
-
VAL
Probability: 92% (predicted by ML model) - Protein sequence
-
MFRMGSLYRTENAMGPIERDIIRLASAVPDEETCGFVLNDGMVVATTNQAANPREEFEIGPVAFAHYEGRIGAIWHSHPGGEPIFSPADVRSCKALGIPWILYHVPTGIFRTADPTGNAPYVGRDWVYGLNDCFGLVTDWLRKEIGFDFPDVDRYDDKPEPSYQILENFPPLMRASGLVEVDGHPAMVMCCSCGLMGHCRTIAL
- Physico‐chemical
properties -
protein length: 204 AA molecular weight: 22596,5 Da isoelectric point: 4,87 hydropathy: -0,10
Representative Protein Details
- Accession
- 1cZKK
- Protein name
- 1cZKK
- Sequence length
- 242 AA
- Molecular weight
- 28156,62650 Da
- Isoelectric point
- 5,12872
- Sequence
-
METPPVLKALIERGPNKEERCGYFFKGQPTTVNNVVELPNVADKPNLHFEFSLEDTMTMLELELEDIVLWHSHLGEDENTLSYYDVLSADSTGLPMFMVNVATGITDFYDPTIEVPYLGREYVFSYQNCYSLVEDFYLKEFSIELPKIYLKYPNEYRSKDWNPYTTELPKYFKEIKLSAAKRGDLILMKIGKTFNPNHIGIVSDPVKNTFLHHLTDRISSEDILNQPYRNRIVSVHRHLSND
Other Proteins in cluster: phalp2_22499
| Total (incl. this protein): 147 | Avg length: 235,7 | Avg pI: 5,64 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 1cZKK | 242 | 5,12872 |
| 13SOj | 235 | 5,72132 |
| 1407O | 235 | 5,22927 |
| 143TX | 238 | 5,86711 |
| 14eU9 | 241 | 6,59488 |
| 15jlM | 235 | 5,06375 |
| 15lZf | 235 | 5,17322 |
| 15s7N | 235 | 5,60429 |
| 16oSi | 235 | 5,62771 |
| 16pW6 | 234 | 5,41757 |
| 16ptt | 234 | 5,02834 |
| 16pvg | 236 | 5,97840 |
| 16qsV | 234 | 5,56882 |
| 16rE5 | 242 | 6,75312 |
| 177VR | 236 | 6,11658 |
| 18saP | 237 | 6,31313 |
| 1Akaa | 234 | 5,37546 |
| 1Ako0 | 235 | 5,62373 |
| 1AprA | 235 | 5,86763 |
| 1GwzM | 236 | 6,20400 |
| 1HRjs | 235 | 5,22927 |
| 1JGCI | 239 | 5,19670 |
| 1LMmE | 235 | 5,21790 |
| 1NPbt | 236 | 6,11596 |
| 1UC7P | 234 | 4,90051 |
| 1UKYc | 234 | 5,07802 |
| 1UviY | 238 | 6,44539 |
| 1XXEd | 234 | 5,29929 |
| 1ZHcK | 234 | 5,37762 |
| 1ZR96 | 234 | 5,37762 |
| 1aCd7 | 239 | 6,04093 |
| 1cPHm | 239 | 5,64453 |
| 1wp2R | 236 | 5,63061 |
| 1xRC1 | 239 | 5,19670 |
| 24j2A | 236 | 5,66460 |
| 24jpv | 235 | 5,33294 |
| 26e0t | 234 | 5,05574 |
| 27NuO | 238 | 5,27127 |
| 27tQC | 235 | 5,03215 |
| 2C36U | 235 | 5,45060 |
| 2cZlk | 239 | 5,30947 |
| 2cuLP | 238 | 5,54518 |
| 2nFBW | 236 | 6,11596 |
| 33zBs | 236 | 6,11919 |
| 3PlCA | 236 | 5,99438 |
| 3SOyW | 236 | 6,25657 |
| 3SbVn | 234 | 5,69637 |
| 3Z7Gu | 235 | 5,62373 |
| 3aV9W | 236 | 5,31401 |
| 3aZAa | 236 | 5,53853 |
| 3cW2r | 236 | 5,42508 |
| 3cXMB | 239 | 5,64772 |
| 42bLS | 234 | 5,10956 |
| 451uj | 239 | 5,19198 |
| 45IKe | 234 | 5,02266 |
| 467Ed | 237 | 5,03397 |
| 46HGF | 237 | 6,20451 |
| 46VPA | 236 | 5,98147 |
| 48dgl | 234 | 5,08751 |
| 49JmV | 234 | 5,26445 |
| 49MHA | 237 | 5,88013 |
| 4BWFV | 235 | 5,18533 |
| 4Jc79 | 239 | 5,20431 |
| 4Q6Zz | 242 | 6,06378 |
| 4Q6vk | 242 | 5,72797 |
| 4TqvP | 242 | 5,89377 |
| 4UZVw | 235 | 5,54768 |
| 4XdLD | 235 | 5,71302 |
| 4aNZg | 236 | 5,79578 |
| 4aRN8 | 234 | 5,28190 |
| 4aTSS | 237 | 6,31313 |
| 4ae1t | 236 | 5,44042 |
| 4au6z | 234 | 5,44196 |
| 4bl63 | 233 | 5,87320 |
| 4dqRH | 239 | 5,19670 |
| 4gmyi | 241 | 5,30725 |
| 4l8aG | 243 | 7,11217 |
| 4qE4I | 240 | 5,93015 |
| 4smg8 | 235 | 5,59969 |
| 4x4VF | 239 | 5,62958 |
| 4xPPF | 234 | 5,26445 |
| 4zSlM | 237 | 6,04604 |
| 4zYdF | 230 | 5,38501 |
| 51aVn | 223 | 5,15486 |
| 51dvT | 233 | 5,92793 |
| 592OQ | 235 | 5,23376 |
| 5D3HR | 231 | 5,49266 |
| 5HKD | 238 | 5,74838 |
| 5HuVj | 234 | 5,36170 |
| 5Hvdb | 235 | 6,34286 |
| 5HwW | 240 | 5,50585 |
| 5Jour | 267 | 4,95087 |
| 5dvL1 | 236 | 5,78799 |
| 5lePb | 238 | 5,86717 |
| 5ooJa | 233 | 5,87320 |
| 5sWGw | 234 | 4,83736 |
| 5vnE8 | 235 | 5,81448 |
| 5ynro | 190 | 5,60781 |
| 5zwwq | 235 | 5,41195 |
| 6IADx | 237 | 6,34598 |
| 6IAuR | 237 | 5,67034 |
| 6IKBT | 237 | 5,46867 |
| 6LLuY | 231 | 5,62043 |
| 6M9Vo | 237 | 5,33084 |
| 6MDiP | 242 | 6,75579 |
| 6MvdL | 235 | 6,11704 |
| 6Q4Zu | 233 | 5,44156 |
| 6Qs15 | 236 | 5,98505 |
| 6W0SM | 242 | 7,68215 |
| 6xqQ9 | 235 | 5,41865 |
| 6z5zP | 233 | 6,05968 |
| 77bZ | 236 | 5,22012 |
| 7C8CI | 235 | 5,46248 |
| 7CXqO | 236 | 6,08157 |
| 7HMSs | 234 | 4,93490 |
| 7pa5K | 235 | 5,85523 |
| 80cqr | 235 | 5,86603 |
| 82DlY | 235 | 5,86763 |
| 82PSF | 234 | 5,07557 |
| 8DyTQ | 239 | 5,87587 |
| 8cTYb | 238 | 5,98341 |
| 8gin0 | 236 | 5,98721 |
| 8hIK3 | 235 | 5,66528 |
| 8lhAl | 239 | 5,28855 |
| 8sFVi | 235 | 5,74923 |
| 8trTH | 235 | 4,99844 |
| ANeC | 235 | 5,34772 |
| AjCA | 242 | 6,75312 |
| Ak3t | 235 | 5,22927 |
| AlzS | 235 | 5,47458 |
| Amrl | 235 | 5,72132 |
| Au8V | 235 | 6,40902 |
| DAou | 236 | 5,79356 |
| DAui | 236 | 5,86603 |
| REjr | 234 | 5,45793 |
| U9fK | 236 | 5,55848 |
| XaCf | 238 | 6,04923 |
| Xb3y | 234 | 5,62515 |
| gDwe | 235 | 5,74338 |
| gKHc | 234 | 5,60997 |
| iA2q | 237 | 6,11675 |
| ih5w | 235 | 5,74338 |
| lgvC | 236 | 5,22921 |
| suMk | 235 | 6,34286 |
| t6X7 | 233 | 4,89824 |
| tJJL | 235 | 5,56854 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_27124
2S85x
|
12283 | 27,4% | 233 | 2.878E-69 |
| 2 |
phalp2_14456
4GZZ7
|
1941 | 26,1% | 241 | 1.254E-52 |
| 3 |
phalp2_32045
5EIkN
|
35 | 25,9% | 235 | 2.041E-45 |
| 4 |
phalp2_16601
8Ajl
|
621 | 28,0% | 232 | 5.218E-45 |
| 5 |
phalp2_4578
4b356
|
332 | 23,6% | 233 | 5.511E-40 |
| 6 |
phalp2_40415
4ciEa
|
15 | 22,0% | 258 | 4.358E-38 |
| 7 |
phalp2_26935
4AzeE
|
31 | 19,4% | 277 | 2.512E-36 |
| 8 |
phalp2_10001
6WaO6
|
89 | 30,3% | 188 | 6.041E-33 |
| 9 |
phalp2_30058
2LEwP
|
69 | 22,2% | 234 | 6.041E-33 |
| 10 |
phalp2_4350
2U0xb
|
58 | 25,0% | 268 | 7.268E-32 |
Domains
Domains
No domain annotations available.
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(1cZKK)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50