Protein

Protein accession
8nWDS [EnVhog]
Representative
1aKpM
Source
EnVhog (cluster: phalp2_35584)
Protein name
8nWDS
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MAIAISVFAFVTPANAGGSCPQWETSIRKAGLPVKEFSYIAHRESRGRINAINARYDKNGKVIWTLNKNGSIDRGLFQINSVHKQTVRAVCEGDLDELLTLPCNLKVAKYLYDRYGMTPWRGHSVIPQSRTDAPPTLGARSLDNLARNK
Physico‐chemical
properties
protein length:149 AA
molecular weight:16557,8 Da
isoelectric point:9,79
hydropathy:-0,36
Representative Protein Details
Accession
1aKpM
Protein name
1aKpM
Sequence length
142 AA
Molecular weight
16005,38600 Da
Isoelectric point
9,64861
Sequence
LKKFFVVLFALLVLNPTVANAKSEVPPKWLVERVENGDRCKKLEPAIAAAGLPVTFFTYMAWRESRCRVGAVNARFNKQGKVVWTLNRNGTFDSGVFQINSSWRTKTREVCGGGLDRLLKWDCNLAMAVELYSDGGLHHWGF
Other Proteins in cluster: phalp2_35584
Total (incl. this protein): 156 Avg length: 149,4 Avg pI: 9,33

Protein ID Length (AA) pI
1aKpM 142 9,64861
154Sl 129 9,91925
15gBd 107 9,58982
162ll 164 9,23324
17Hqn 164 5,73246
18GyI 163 9,76117
18nfz 135 8,74786
18v2s 164 8,94430
19F6I 135 9,83061
19UsN 170 9,04390
1ELD1 174 8,32701
1I1ai 130 9,85394
1JMbm 126 9,43503
1JqRm 128 10,30986
1Kc5z 175 9,13873
1KdBP 164 9,29687
1MkZR 164 9,35264
1OAnI 164 9,88579
1PdED 161 9,70928
1aAYs 142 9,85485
1iBAK 188 9,64623
1iL6t 174 8,60874
1jxtG 82 10,29845
1sN7E 114 9,00032
1tLNZ 128 10,25758
1wV7U 164 8,77900
1xNZg 173 8,28137
1ya3B 175 9,02424
1ycTu 128 10,22328
20xtw 164 9,07626
2696p 127 4,74989
28gEk 127 5,59912
2JP3L 127 5,21898
2Qi4C 148 9,48506
2ZWVN 123 9,78206
2hAxY 173 9,39802
2iGac 134 9,41640
2jjtN 181 8,40837
33w9d 180 6,03752
362P3 81 10,10241
36HsD 169 9,56461
37tjJ 128 10,25758
3VX0V 171 9,47558
44yO4 176 9,81140
45TBR 128 10,54872
46RwF 164 9,97850
46ud5 164 8,88073
46wwH 164 9,02075
47Jpm 173 9,09554
48ODa 128 10,69435
49Tt6 164 8,77900
4AeNi 164 9,69019
4GEJ6 128 10,48606
4NQxO 145 9,56506
4V91e 153 9,62315
4aG2X 169 8,38890
4b0PD 169 8,67778
4bcZi 164 9,41833
4bvte 132 9,76917
4fHre 158 9,79960
4mRUK 133 9,32608
4mUH7 129 9,69342
4mk5I 165 9,52696
4nx32 142 9,91712
4oYY2 164 9,02114
4opnI 153 9,65667
4p6UA 164 9,97656
4qkBW 128 10,35428
4s2Ag 164 8,39812
4x0eg 144 10,10408
4zXxD 164 9,77768
503Ly 152 9,72965
50LR7 102 10,13509
50aK8 164 9,02114
52wz7 124 9,60787
5677d 164 10,11137
56Lc2 128 10,22322
56M2Q 145 9,18405
57UNF 159 10,01724
58UKf 164 9,02114
58vQs 148 9,18025
5AAiV 148 9,83576
5AVsm 164 9,23337
5AtBW 164 9,20578
5C4r4 113 10,30310
5bOMv 128 10,54872
5bhj9 147 9,38893
5c4Ug 144 10,15256
5cMqO 155 9,75705
5cY8A 137 9,28391
5fRWO 148 9,76975
5g4kF 164 8,77951
5gi2M 144 10,18731
5gvCL 128 10,70512
5hAfi 154 9,08110
5hMxC 164 9,04390
5i7tb 128 10,30703
5iO78 128 10,54872
5leTU 179 9,41214
5tlXj 128 10,22322
5v2Rm 148 9,56867
5vdvg 142 9,83525
5vtxW 164 9,23311
5w0kf 144 10,18731
5wVOI 164 8,73200
5wpMb 164 9,02114
5wwpy 164 9,26341
5xsFp 164 8,76295
5yRDp 121 9,79998
5yylm 128 10,22328
5ziO3 128 10,15263
6A16c 117 6,75357
6Ap1u 128 10,54202
6GLPo 161 9,88134
6GeGB 113 8,96241
6Is7A 129 9,92815
6KwWN 111 9,63482
6xN5W 128 10,10292
6yPwz 175 8,99342
6yb17 148 9,73004
6zDQ2 161 9,02121
6zenI 128 10,54202
7XUex 179 5,40206
7Xhcg 128 10,40882
80Oiv 176 9,27431
81UT5 176 8,91232
81r53 128 10,41295
82J3g 130 4,98361
84uMk 142 9,84788
8B1NQ 135 8,38742
8mtVU 164 9,04345
8ogWd 157 9,66763
8rts7 129 9,72591
8xlVe 190 9,63404
AGM9 130 9,23137
Chl0 174 8,34790
Hiyv 164 9,32453
IIkQ 179 8,88801
Pi0k 164 9,20565
RRQz 138 9,32653
T1LN 176 9,09947
Ub45 128 10,25758
UfEl 135 8,38748
X9e0 164 9,85285
aziD 153 9,69342
bTf2 164 10,16539
hOdk 174 8,32901
hXtA 132 10,18905
sTDH 175 9,12822
suH0 180 9,41214
t488 152 9,65764
tB7d 164 9,04319
zZcx 135 9,27650
zeZq 178 8,32901
A0A6J7XPR1 171 9,15678
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_5595
4aSfH
29 48,3% 118 5.649E-56
2 phalp2_23920
1O60H
47 40,7% 152 1.724E-50
3 phalp2_39980
1L23W
13 38,3% 99 9.885E-25
4 phalp2_8459
165nm
626 28,2% 124 5.428E-19
5 phalp2_26521
7XVtu
369 28,8% 125 3.912E-13
6 phalp2_39934
1p4NQ
5 27,0% 148 2.554E-12
7 phalp2_10602
5BOvL
251 28,0% 107 4.772E-12
8 phalp2_9463
ADPc
1205 26,3% 129 6.522E-12
9 phalp2_8391
CgjB
207 26,4% 106 8.913E-12
10 phalp2_9230
6SW0S
30 24,2% 128 7.922E-11

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 1aKpM (142 AA)
Member sequence: 8nWDS (149 AA)
1 142 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (1aKpM) rather than this protein.
PDB ID
1aKpM
Method AlphaFoldv2
Resolution 90.03
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50