Protein
- Protein accession
- 8mWsW [EnVhog]
- Representative
- 5coeD
- Source
- EnVhog (cluster: phalp2_18305)
- Protein name
- 8mWsW
- Lysin probability
- 99%
- PhaLP type
-
endolysin
Probability: 99% (predicted by ML model) - Protein sequence
-
MGHPYKAQKVPATLSIYGNGKIPASALGKLSAGGTAWASSVYAGGPAFAFNLMYDDALKDGIQLRAVSGGYRSLEGQEALFFSRYDLVDHGRVPQITRQYKGRTYFLKPGMSPSASPGTSPHGWGCAQDFDVSHGAYEWLCKNGPKYGAYLQGPPSYLGRPNPEYEAWHWQIADPEKPTWKVRRAWRKFLKALGGK
- Physico‐chemical
properties -
protein length: 196 AA molecular weight: 21547,2 Da isoelectric point: 9,58 hydropathy: -0,53
Representative Protein Details
- Accession
- 5coeD
- Protein name
- 5coeD
- Sequence length
- 126 AA
- Molecular weight
- 14546,26850 Da
- Isoelectric point
- 9,15401
- Sequence
-
MVRVAEQDGVQLRSLGGGYRDYARQEALWYDRMTRSRDEAKQPLVRRVWNGKLWFLKKAAPVAVPGTSNHGWGLSVDFDISDPLVYAWLDKHGPSYGFYMEAKPTKSDGSKNPYFEPWHWTKVDLP
Other Proteins in cluster: phalp2_18305
| Total (incl. this protein): 66 | Avg length: 177,9 | Avg pI: 9,70 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 5coeD | 126 | 9,15401 |
| 189uG | 192 | 9,02598 |
| 1PK3o | 172 | 9,91351 |
| 1iEM5 | 211 | 9,70509 |
| 1jvE1 | 184 | 9,49073 |
| 1o8zy | 176 | 10,18609 |
| 3UKep | 172 | 9,89759 |
| 3Wsn7 | 196 | 9,55268 |
| 3XtGF | 196 | 9,38326 |
| 3Y37X | 172 | 9,92899 |
| 3YIyz | 143 | 9,17451 |
| 3YsnK | 202 | 9,28333 |
| 43Scr | 196 | 9,57589 |
| 44vIw | 172 | 9,89765 |
| 45U5s | 185 | 8,43783 |
| 49LAX | 172 | 9,69587 |
| 49TPj | 190 | 9,33259 |
| 4NHIU | 165 | 10,07836 |
| 4NI4B | 201 | 9,35915 |
| 4NJPb | 172 | 10,00596 |
| 4NLzf | 169 | 9,86336 |
| 4NR4u | 199 | 10,12387 |
| 4bZy8 | 201 | 9,35915 |
| 4l2Yq | 172 | 9,61780 |
| 4lnMH | 166 | 9,92615 |
| 4mfG8 | 170 | 9,78709 |
| 4n7NZ | 151 | 9,95529 |
| 4oeu6 | 177 | 10,26222 |
| 4pgKD | 178 | 9,72759 |
| 4qLXm | 170 | 9,93808 |
| 4zMts | 151 | 10,04342 |
| 4zOYi | 168 | 10,23689 |
| 4zR77 | 151 | 9,95529 |
| 50jBk | 172 | 9,93588 |
| 52wer | 192 | 9,34458 |
| 58z1G | 175 | 10,15404 |
| 5AtJW | 187 | 9,94298 |
| 5c5ds | 170 | 10,00486 |
| 5cLAI | 180 | 9,91190 |
| 5cwF9 | 178 | 9,96934 |
| 5dqHb | 184 | 9,49073 |
| 5ey1s | 198 | 9,57647 |
| 5hmKa | 196 | 9,57589 |
| 5lsYw | 125 | 10,25171 |
| 5me5c | 188 | 9,46314 |
| 5o1J5 | 172 | 9,76865 |
| 5z6tp | 202 | 9,28333 |
| 5zpd7 | 172 | 9,89759 |
| 5zwic | 166 | 9,89514 |
| 6IwLD | 170 | 9,98739 |
| 6xFL5 | 151 | 9,95529 |
| 6xfeO | 196 | 9,57551 |
| 6z2XB | 145 | 8,93082 |
| 6zAGa | 151 | 9,90623 |
| 7VwAH | 202 | 9,65293 |
| 8833C | 193 | 9,24523 |
| 8mtUp | 185 | 9,18450 |
| 8mvPf | 173 | 9,16091 |
| 8t1EQ | 172 | 10,08107 |
| 8t4Km | 177 | 9,98088 |
| G7nL | 212 | 9,40698 |
| Hevu | 172 | 9,96999 |
| Jk0o | 201 | 9,45746 |
| JraO | 165 | 10,11943 |
| aH3h | 206 | 9,69606 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_26267
LAL7
|
1473 | 45,1% | 124 | 1.035E-49 |
| 2 |
phalp2_24588
55Me8
|
25 | 31,0% | 129 | 3.768E-12 |
| 3 |
phalp2_6920
2GDF5
|
10 | 30,0% | 133 | 1.324E-11 |
| 4 |
phalp2_6689
1OyY1
|
2 | 23,5% | 136 | 1.191E-10 |
| 5 |
phalp2_14536
7InCk
|
1 | 23,9% | 142 | 9.163E-06 |
Domains
Domains
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(5coeD)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50