Protein

Protein accession
8mNNX [EnVhog]
Representative
6lrSj
Source
EnVhog (cluster: phalp2_28993)
Protein name
8mNNX
Lysin probability
97%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
MLLCLRTDILRMPMHINIGNMHQRGMRCNLCPLVKSKKGVYVSAHLTGNGIDFTCDDKTAEEIREMIKAKPLLLPCKVRLEEDCDWVHLDVYDDGTEDKITTFKA
Physico‐chemical
properties
protein length:105 AA
molecular weight:12022,0 Da
isoelectric point:6,40
hydropathy:-0,24
Representative Protein Details
Accession
6lrSj
Protein name
6lrSj
Sequence length
93 AA
Molecular weight
10880,34240 Da
Isoelectric point
5,56803
Sequence
MIVNGGSAYTQRGLRCNMCALVKEKTKLYMSAHCLGKALDFHTKEYTPEQCRQLIKDNIDMFEYPIRLEEDVNWVHVDTYTLNDNEKLVTFTE
Other Proteins in cluster: phalp2_28993
Total (incl. this protein): 166 Avg length: 93,1 Avg pI: 6,81
Protein ID Length (AA) pI
6lrSj 93 5,56803
125xW 75 6,07776
14CnV 115 8,92927
1mdsm 94 7,70029
2lYHZ 114 7,67550
3GH0Q 92 7,67647
3GNAl 92 6,88175
3If0G 92 6,88504
3LXYe 92 6,04042
3kq85 92 6,04042
3l5hH 92 6,39668
3m6BI 92 7,62270
3mlqG 92 6,88089
3mpCE 92 6,88771
3t36u 92 6,39668
3tG5K 92 6,87726
3uTjd 147 8,53021
3uonC 92 6,88504
3wLIf 92 7,69960
3x1rI 92 6,88504
3x4Dj 147 8,53021
3yrSH 147 8,21058
4ymel 79 7,69017
5L3B3 94 6,88504
5Leub 94 6,39668
5LrPy 94 6,88504
5MHHR 93 8,38033
5MLIK 94 6,88504
5MNQ3 94 6,87726
5Meao 94 7,62270
5Mee8 92 6,88504
5NP70 94 6,04042
5OBw2 94 6,04042
5ORzP 92 6,88504
5PKe0 92 8,38748
5QCQY 94 6,88504
5QXjJ 94 6,39668
5QaH1 67 9,07136
5QyXl 94 6,88504
5RPRJ 94 6,80172
5RSLA 94 6,88089
5RZey 94 6,87726
5Rkt1 94 6,39572
5Rpla 94 6,87726
5RrCa 94 6,39572
5Tt4Q 94 6,88089
5U4HL 94 5,73485
5U67y 92 6,39572
5UC2U 94 6,88044
5UDLN 94 6,39668
5Unja 94 6,39572
5VFbk 85 6,80837
5VMWK 94 6,88504
5VP6N 94 7,60002
5W3xx 94 6,88504
5XCuT 76 6,06292
5Y0U2 94 6,39668
5Ypcq 85 5,86029
5ZYCX 94 6,04042
5ZxV4 77 8,79911
5ZyR7 76 6,06167
618dH 94 6,39839
61WdY 94 6,88504
61jiN 92 6,88504
62e12 94 6,04081
62kv9 76 6,06037
62r6L 92 6,88504
62x4W 94 6,88771
637ff 76 6,06236
639eN 94 6,88175
63GIk 94 6,88504
63Hwd 94 7,62270
64GGu 94 6,39572
64rNW 94 6,88504
671g8 94 6,39572
67A8K 92 6,88504
67AfK 94 7,65839
67FDS 94 6,39469
68BFN 85 7,60349
68BOj 94 6,39668
68GEg 94 6,88504
68JHa 94 6,87726
68JOZ 94 6,80797
68XyO 94 6,88504
68n3c 80 6,05980
697Tr 94 6,88504
69ZnJ 94 6,04042
6UOyR 100 9,05931
6aXBt 94 6,87726
6bIPv 71 8,79866
6bPN0 94 6,88175
6bS1M 80 6,05980
6bjqk 80 6,70225
6brA2 94 6,88771
6dPj2 76 5,58656
6eQpy 94 6,39572
6eRn5 94 6,39759
6eSH4 92 6,88504
6eSHL 94 6,88504
6euit 94 6,39572
6f2kP 76 5,56956
6f2lN 94 6,88504
6fFfo 76 5,60321
6gtPt 94 6,39572
6hCOW 94 6,88175
6hMiT 94 7,69960
6hPC4 94 6,88504
6hsw6 94 6,04042
6i12J 94 6,88175
6iXb7 94 6,05940
6k4eY 94 7,62549
6k8w3 94 6,88504
6l9yK 76 5,60321
6lDmO 85 6,80837
6lUIT 94 6,04042
6m5Ef 94 6,39572
6mAly 76 5,01305
6mkqa 94 6,87726
6mkwc 94 6,88504
6msPQ 94 6,88504
6mws1 92 6,04042
6nv7N 94 6,88504
6ogzK 94 7,69960
6olnl 92 6,88504
6p38s 94 6,88089
6p5rf 94 6,39668
6pID5 94 7,69960
6ppZK 94 6,88504
6qfgC 76 5,24495
6qgcI 94 6,88504
6r1BY 94 7,62270
6r2HA 94 6,88504
6rTgZ 94 6,04042
6rvEd 94 6,87726
6sXPN 92 7,69960
6u8Eq 66 4,52844
6uWjN 94 6,39668
6uWne 94 6,88504
6ul43 94 6,87726
6v63B 76 5,24495
6vSsT 94 6,88089
6vjvy 80 5,59821
6vnHX 94 6,88504
7W4hy 92 6,88504
7WYeV 92 7,69960
7YWGO 92 6,88504
7Ymv1 92 6,88771
7YwkG 114 7,67550
7Z6nc 92 6,88504
83V4G 92 6,26527
83nqE 92 6,39469
8672W 92 6,88504
8MQBc 148 8,11059
8aTKt 92 6,88175
8dcnq 114 8,50662
8fExt 92 6,39572
8hP2M 114 7,64032
8kOJO 92 6,88504
8laK2 92 7,62236
8lmaz 92 6,88175
8nxZo 80 6,24992
8suUt 114 6,93915
8ul7d 114 6,94399
NmBY 94 6,39668
oJ73 79 5,16129
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_16210
4JB3U
 55 60,3% 63 7.781E-21
2 phalp2_1968
4BR1x
 969 36,9% 92 2.150E-17
3 phalp2_34245
39R4E
 1 28,7% 94 1.220E-14
4 phalp2_21423
89xvs
 2 35,4% 62 3.319E-07
5 phalp2_25932
6bZlr
 11 28,7% 66 6.253E-07

Domains

Domains
Unannotated
Representative sequence (used for alignment): 6lrSj (93 AA)
Member sequence: 8mNNX (105 AA)
1 93 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI] 		UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (6lrSj) rather than this protein.
PDB ID
6lrSj
Method AlphaFoldv2
Resolution 92.32
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50