Protein

Protein accession
8hGcZ [EnVhog]
Representative
4udWf
Source
EnVhog (cluster: phalp2_3524)
Protein name
8hGcZ
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MIHLLLAIAFVESSFNPMAIGDGGEALGLLQIHKIVVDDVNRIYGTNYEYHDRLDPFKSMRIFDRYIKHWLPKAKRNGATDMMDEEIIARIWNGGPNGWKKDSTIDYWHKVAKYLHSGQ
Physico‐chemical
properties
protein length:119 AA
molecular weight:13775,6 Da
isoelectric point:7,02
hydropathy:-0,38
Representative Protein Details
Accession
4udWf
Protein name
4udWf
Sequence length
137 AA
Molecular weight
15946,37790 Da
Isoelectric point
9,22596
Sequence
MRKLLFFALFIPIKCYAPGFSYEINHDEFLSILWGVVMVESAGDMKAYNPAENAVGLLQVRQCVIDDINYYYGTNYKLEEMYNPLKAITVFKRYLDIYGNDVRIWNGGPKGHKKTATIKYKNKVNKYKRNIVEINIS
Other Proteins in cluster: phalp2_3524
Total (incl. this protein): 232 Avg length: 129,7 Avg pI: 8,29

Protein ID Length (AA) pI
4udWf 137 9,22596
11lZB 132 9,60967
13KNi 123 8,71582
14wMS 143 9,49769
18jvv 123 9,34864
1AbVK 120 6,28289
1Al2A 122 9,51510
1CWer 122 7,72632
1Cp4h 123 9,09921
1KmeS 113 8,96293
1L5T4 190 9,72449
1NxCN 133 9,39635
1SFAT 134 9,80108
1SldE 122 5,69938
1UGmQ 140 9,06556
1UMs6 122 9,42658
1VO1A 131 9,64532
1WggN 122 9,38906
1XIEc 131 9,51258
1g4xm 123 9,48151
1oZtl 123 8,91374
1rbDh 119 4,81798
1rjuc 116 9,29778
1tHqz 112 5,62936
1toWC 118 9,61238
1uwpY 116 5,88741
1wtur 123 8,38606
228UO 109 5,63942
22bqi 105 7,80843
24iHH 124 9,03893
28Tc2 140 9,03017
2Ei5E 131 8,25249
2HKKr 114 9,39293
2LPBX 132 9,75692
2NTrs 149 7,01924
2NaWV 125 9,05512
2PlWr 126 8,39747
2Rqhx 122 9,23821
2Rz7h 123 10,47065
2anMm 129 9,63533
2b3j9 134 9,09747
2q8rY 108 5,53927
2rwVc 138 5,05614
2woJp 122 9,59659
2xCPR 119 8,83270
2yrCW 131 9,14312
2zgy1 127 8,83193
2zoWt 140 8,68133
33Rht 115 9,85839
369Ro 163 8,97350
3BAP4 140 7,84601
3Bum6 124 9,01811
3CDLz 136 9,43387
3Csd3 121 5,56519
3DzFM 126 6,90084
3FATg 154 9,54037
3FRAZ 106 7,98746
3GTca 123 9,67891
3I3MJ 136 5,87860
3JzvS 119 9,65403
3M2Aj 125 9,37984
3RtqJ 121 9,51658
3T8rG 140 9,83022
3ViMS 122 8,77391
3X0By 122 9,35825
3eAyA 166 6,90238
3i7M4 146 6,06651
3ieVZ 139 10,22805
3jaA2 130 7,70813
3njFd 117 9,14621
3np8G 121 9,58182
3rCo4 150 6,20116
3rFhD 124 9,01521
42OPg 140 7,05869
430bf 133 8,88653
43eVJ 140 9,29687
43gzp 131 8,56587
45YpP 114 10,08178
46vkL 176 9,78967
473SR 123 9,17316
48oQF 122 9,29913
49KEQ 109 10,19659
49g9k 128 11,22712
4MVQW 133 6,89647
4R6hc 127 4,76376
4WTld 117 6,08896
4Wz4I 160 8,24256
4hVBY 131 9,26432
4l6i3 117 10,50372
4lulx 119 9,99771
4wHC7 131 9,33252
4wQKF 117 9,76820
4zAPE 127 9,92228
4zMia 186 9,75872
5BLmz 115 11,37933
5FbnE 117 8,23508
5be6s 115 11,24324
5d6ZH 112 10,06147
5i6Pf 115 10,18119
5lYwi 115 11,24324
5muE3 119 9,83383
5qmxr 121 8,84289
60nnh 140 9,00096
67OK 115 9,51845
6B3Qc 133 8,53499
6B5kP 120 6,89891
6OFji 123 6,57516
6OrT5 119 6,72618
6Qxcg 114 9,55281
6Wkup 127 5,70041
6pQwO 140 8,81233
7CdLH 142 4,87436
7CwXq 132 9,56268
7DPLS 144 9,78322
7DfW4 115 6,72368
7DlhF 140 9,02972
7DnYC 136 8,79647
7DtAo 127 9,20475
7DyVm 136 8,96099
7IUoF 123 9,15195
7JKc7 161 9,05969
7TINN 127 9,39216
7Tup5 140 9,24227
7TyYT 120 9,27831
7U4rj 122 9,41891
7UDcZ 140 4,81690
7VFA0 119 8,00151
7VFhr 140 9,24807
7VFoR 122 9,32318
7VR5r 150 9,20101
7VpsK 136 9,92305
7VxKL 123 9,43432
7Wank 128 5,28741
7Wxh9 138 6,35627
7YKbj 139 7,61190
7YKoO 126 7,70119
7ZIEq 123 4,69288
7Zo9I 125 8,98497
7ZopJ 116 9,20501
7ZxGA 140 9,07497
80J0L 140 9,06608
80Nmn 111 10,83419
80Xjt 124 9,01869
80arx 130 4,95547
82N5u 146 9,51452
82Ty 158 7,09302
82ekz 140 6,90471
83OtB 148 4,65570
84Fvg 119 9,55668
84Vga 129 5,92310
84nF0 124 8,47658
84uXB 114 10,80163
872k9 131 5,77816
87mwD 136 10,75940
88Nnj 121 6,71907
88R42 150 5,93651
88Sgf 121 8,64465
88SwE 119 8,00151
899Um 135 7,63049
89D8Z 154 9,53998
8AAvl 137 6,17274
8Anw1 136 5,48709
8Avuh 171 9,03055
8BMgn 124 8,81375
8CAeg 140 6,18308
8CJBk 121 5,29588
8CK29 150 6,20116
8CRkS 135 7,63049
8CVBZ 125 9,25729
8DUEm 127 9,88927
8F2qt 194 4,37134
8F7ry 133 9,87870
8FF12 126 6,90084
8FG1Z 136 9,43387
8aa5B 123 7,62213
8b6pr 111 10,85198
8b7XH 136 8,26564
8b8TT 111 10,33559
8bZGb 129 6,40686
8bZIn 158 6,41510
8bwZj 146 9,53663
8bxj6 131 5,69847
8c09r 121 5,09723
8c2Ec 124 8,79022
8c41c 124 7,73115
8c80g 149 5,58855
8cfXy 140 9,43909
8dBZX 141 9,97018
8ef7B 121 9,62624
8gAdp 131 9,15195
8gHuk 127 9,03590
8gnE8 167 6,86600
8grbl 140 10,10911
8hGKU 109 5,53910
8i2e2 122 9,11971
8imKC 140 9,24807
8kCiO 110 8,94539
8kk2x 139 5,12889
8nFo9 139 5,33550
8pZCi 144 9,93608
8rcHy 114 9,93898
8rcV0 116 10,33791
8stnd 115 9,98939
8t3Mt 129 10,23282
8t6Nb 102 9,74893
8tvqT 120 5,65300
8ujBo 136 8,79647
8uqCR 150 6,20116
8uqsn 146 9,42097
8vHL8 124 6,81155
8vMjK 111 10,32514
8wXFX 150 5,93651
8x22M 124 8,85610
8xzK3 140 9,06556
8yoX7 113 6,72248
8yxeK 120 5,62930
8yxeR 122 5,78504
8z62T 109 5,53910
8zdzX 126 7,70119
8zvHA 121 8,70389
Ep4i 135 5,54370
P7gv 142 5,70251
TNqD 118 11,18103
e35O 116 5,57689
gDJ5 129 9,67176
iwZd 129 5,68477
jLxZ 115 10,18518
kkdG 124 5,41934
r0sd 136 5,27752
rSW4 115 4,61740
v21P 140 9,21700
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_20516
4eE8g
949 34,9% 126 1.857E-43
2 phalp2_23047
4ccMQ
55 36,7% 106 1.461E-37
3 phalp2_11423
8xVfQ
883 29,3% 143 7.342E-34
4 phalp2_7110
2jvCh
6 30,5% 121 1.257E-32
5 phalp2_23582
1f8D
174 44,5% 101 1.723E-32
6 phalp2_46
7Exor
250 37,0% 108 2.363E-32
7 phalp2_5196
3O9Fp
630 28,1% 135 4.441E-32
8 phalp2_11808
8aeor
7 34,9% 103 3.680E-30
9 phalp2_40097
85aZL
71 36,0% 125 3.680E-30
10 phalp2_9791
8rvVm
13 33,9% 106 6.293E-29

Domains

Domains
Disordered region
Unannotated
Representative sequence (used for alignment): 4udWf (137 AA)
Member sequence: 8hGcZ (119 AA)
1 137 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (4udWf) rather than this protein.
PDB ID
4udWf
Method AlphaFoldv2
Resolution 85.85
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50