Protein

Protein accession
8aY6l [EnVhog]
Representative
6REqE
Source
EnVhog (cluster: phalp2_26018)
Protein name
8aY6l
Lysin probability
99%
PhaLP type
endolysin
Probability: 86% (predicted by ML model)
Protein sequence
MAFRLSARSLRNLEGVHPDLVAVAKRAIVITKVDFGVTEGLRSAERQAALKAAGASTVNESRHQTGHAIDVAAYIGPRVSWELPLYYDIAHAFQSAAAELAIPVRWGGCWMLLSGLPHTPRGIGQAVQQYSDSRRAQGRRAFIDGPHYELPASRYPA
Physico‐chemical
properties
protein length:157 AA
molecular weight:17102,3 Da
isoelectric point:9,72
hydropathy:-0,15
Representative Protein Details
Accession
6REqE
Protein name
6REqE
Sequence length
184 AA
Molecular weight
20751,51410 Da
Isoelectric point
6,77557
Sequence
LTIPYYRVHFQLIREVSPKRKPPGSAVAAFFVPDYPATVLLHFLPGHAPGFLFLEVAMPFKLSSRSLSRLSGIHDDLFSVVERAIQITEVDFTVLEGLRSKSRQKELFDSGASTTMNSRHLTGHAVDLGAWVTGGVRWDWPLYYKIADAMKHAADELGIPLEWGGDWETFKDGPHFQLPWKAYP
Other Proteins in cluster: phalp2_26018
Total (incl. this protein): 256 Avg length: 145,2 Avg pI: 8,43

Protein ID Length (AA) pI
6REqE 184 6,77557
1076n 122 9,04699
10R6G 157 5,52330
10UId 143 5,30839
11fpK 154 6,20872
16TwD 153 9,24884
16ZEv 129 10,31541
16ybd 200 4,97400
17crj 156 7,02691
18oyP 122 7,89630
1AQ32 126 8,96144
1CswN 155 9,91145
1HTrN 135 9,03990
1KLkf 133 5,92151
1KQh2 122 9,59201
1LCyq 122 9,46539
1LoiS 122 5,57377
1NRYm 161 9,88128
1NTl0 157 9,74422
1NuDM 158 9,78761
1QYzJ 150 6,42618
1a0wD 163 9,38919
1b145 162 9,35947
1cy1k 108 9,75215
1dLT4 158 9,62237
1fVsv 155 8,52525
1gmvT 152 9,29836
1jhAH 166 5,78862
1kC8x 153 7,02333
1lLok 159 9,58105
1mseH 158 9,25548
1nFQA 158 9,40789
1nnIP 132 6,40208
1oXbL 155 6,57698
1pgjt 134 9,09812
1pmsv 123 9,47300
1q7wC 126 6,06253
1qQJW 167 9,01386
1qQxo 214 6,06633
1rxtg 164 9,12803
1slrP 160 7,90442
1yDzT 161 8,49463
25eUO 154 8,75985
26T2Y 143 5,38671
295wE 122 9,18747
2CbmR 158 9,30003
2G9ha 155 9,68156
2Ggtv 145 7,78309
2I7eB 132 5,93129
2Z5Mo 122 8,89098
2ZCgf 134 8,86107
2aDeO 124 11,06950
2aK1H 129 9,30197
2aaVB 157 6,23168
2ajcy 165 9,32492
2cK6j 127 7,82313
2cLzb 166 5,28270
2ce11 161 10,17255
2gpKV 156 9,35992
2k37F 186 6,71032
2oSx9 122 8,77855
2qS6R 150 5,72252
2rdJz 122 8,00473
2s7tq 170 7,80688
30wnP 122 8,96718
32AVA 155 6,20036
32VP0 142 10,16243
34pLS 125 10,21078
35HJr 153 5,67108
3SdNk 163 9,48383
3aYSk 138 8,08390
3bIBM 166 6,59141
3c65J 137 8,70428
3dFsh 167 7,87244
3e5Dk 158 9,55442
3e5c7 158 9,47145
3g85R 139 9,51400
3yTz5 166 5,78862
4526d 169 6,24765
456yl 155 6,23253
47Tqx 199 9,61457
48mS5 151 6,65109
49i29 146 6,83059
4B7Ck 137 7,91461
4BZ7x 127 10,21078
4C4L1 133 7,98391
4DI4R 164 9,59626
4DYX3 141 6,40907
4F5ry 168 6,48058
4GjsA 151 7,89888
4JlX1 155 5,58110
4KtBk 153 10,29671
4LGjH 151 8,11517
4LYR6 213 9,26580
4Mv3B 146 9,39145
4NJBM 136 10,04948
4NN62 137 10,09241
4RsRI 128 9,51297
4Rw1D 202 6,18592
4T3sp 128 9,85465
4UsHc 159 9,03732
4bd1q 124 9,97824
4eQ0y 122 8,80285
4eSZw 133 8,92940
4eTB6 159 8,54317
4eulI 123 10,12665
4fPLI 132 6,06645
4fsTw 144 9,58266
4fu0R 126 9,84685
4fxd3 144 9,45456
4grQ3 155 6,20121
4jqrI 138 6,51053
4kVcX 180 8,49502
4ok6B 132 6,41220
4vF8s 158 9,56603
4xA4e 171 7,81649
4xQmV 166 9,01302
4xvEH 138 8,96370
55Y9s 127 9,00322
5C93z 122 7,98874
5FqwJ 160 5,66301
5GOAe 157 8,07101
5IiJ1 172 5,80158
5Iyxq 138 8,11136
5RtNN 137 8,63930
5SvAu 123 8,66005
5WZ0G 137 8,98020
5cuyl 129 10,18125
5diYJ 124 9,97824
5j22z 158 9,56680
5lotW 110 7,98662
5ni7B 132 8,21251
5sQBr 218 8,86248
5vxlU 136 9,96174
5xZAu 156 6,29289
61xsT 137 9,00709
6A0Ik 126 9,56828
6ACkh 160 8,73400
6CIkX 158 9,29629
6DfEZ 166 5,71041
6LEEu 166 6,41641
6LaUz 123 6,74300
6MjDa 122 9,47339
6Nvpy 110 7,98623
6Q5IC 146 8,85507
6Qiw2 122 9,22190
6SZdP 167 10,03484
6TSpM 125 5,48993
6VwBj 205 5,67574
6VxcT 127 9,89791
6W1yc 138 8,96376
6Z3BS 146 9,26084
6ZYD7 137 8,00389
6fpvq 128 9,56977
6g5tV 137 8,62202
6hZPw 137 8,98020
6q70n 142 9,10166
6xIDC 121 8,89098
6y9bM 160 6,41766
6zqQ4 126 9,56828
72Knx 152 6,10487
72uuz 155 9,56680
7BPLB 157 9,47197
7FjvT 133 6,28812
7Fws4 123 5,45270
7Mfip 129 9,51916
7OpfS 129 9,69380
7VrXg 126 9,73848
7Y68d 155 6,51286
7ZRFG 160 9,17200
7cqA5 168 8,88821
7dFp 147 10,18144
7izR 122 5,59849
7jTGu 167 9,47087
7jtNo 158 9,16246
7mHbq 163 9,66860
7qwsy 125 9,39635
7rPl4 163 9,62515
7rVCS 157 6,03342
7s2l2 191 7,14321
7sWWJ 158 9,75756
7sdWU 163 9,66860
7vavX 168 9,39416
83EiE 119 9,39570
83d7c 122 9,03945
84Yj0 157 9,55127
84qSo 153 9,51781
85EKd 122 9,22144
87FPo 126 9,29823
881jD 126 9,56822
884In 127 9,27270
88Cst 126 6,91204
8IE5H 166 5,78151
8IE64 166 6,58891
8IE7K 163 9,37075
8L1Pp 166 7,02356
8dKo9 170 7,93833
8e2w7 150 6,03604
8jGre 122 7,97140
8njG3 143 9,32995
8r95f 160 9,93137
8s3tr 145 6,97155
8sJWs 137 9,03023
8v4lT 151 6,07657
8wSYU 128 9,26728
8xAPO 128 9,62508
8xxCe 128 9,21132
8zFbm 126 9,69380
9a4l 130 9,44715
A8hG 142 10,56993
Avlt 145 6,10476
BFOI 128 9,30132
DWUv 157 9,15330
GCbj 125 10,21078
HMTT 137 8,68139
MaWA 127 9,74693
O2gE 137 9,00657
R8S6 156 9,69187
TmCq 154 7,81629
XYkP 153 9,29558
Y4w0 162 8,78661
ZXOF 153 6,52480
e4Am 150 7,86509
eL6A 131 9,68600
eTh3 145 9,58266
kQxB 133 9,55210
kdzz 159 9,04674
l4NY 166 5,53574
sNFB 122 9,47345
suZv 122 9,12829
wN0x 137 9,00657
z2ee 169 10,04367
A0A173H0V8 130 5,90730
A0A2D1GMU0 129 6,18467
A0A5B9NII0 127 9,42452
W8VYN4 163 9,12358
A0A653FSH6 130 9,51800
A0A4Y5TMR6 163 9,12358
A0A5Q2W697 138 9,12539
A0A0A7NQ86 130 9,51800
A0A6J5LXX6 156 9,39512
A0A6J5M278 127 8,66650
A0A6J5M3A0 122 6,83940
A0A6J5MXI3 126 9,90584
A0A6J5P127 126 9,84279
A0A6J5S2G4 126 6,64632
A0A6J7XCU5 127 9,98211
A0A9E7LGC5 130 9,29874
A0A9E7NWP6 122 9,65564
A0A9E7T5D9 122 9,65564
A0A9E7T5F8 122 9,65564
A0AAD2GEY4 138 9,09754
A0AAF1K139 129 9,16181
A0AAX4QDM5 127 9,29887
A0AAX4QFK7 128 9,29732
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_13949
8Fkan
8452 70,8% 127 2.505E-74
2 phalp2_15106
eKg9
268 56,8% 139 4.231E-63
3 phalp2_1400
1mRwO
571 50,0% 154 8.361E-57
4 phalp2_33495
7ykGZ
86 50,6% 156 3.326E-54
5 phalp2_28914
5wnp3
97 47,0% 155 2.793E-49
6 phalp2_27432
4Rvdx
79 50,3% 133 4.750E-48
7 phalp2_6390
3Fng
1 47,5% 122 4.373E-44
8 phalp2_15082
1DVW
42 52,1% 117 1.539E-43
9 phalp2_1169
8ySPz
5 42,2% 154 3.578E-42
10 phalp2_18798
1dhYs
557 42,1% 147 1.138E-40

Domains

Domains
Representative sequence (used for alignment): 6REqE (184 AA)
Member sequence: 8aY6l (157 AA)
1 184 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF13539

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (6REqE) rather than this protein.
PDB ID
6REqE
Method AlphaFoldv2
Resolution 84.08
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50