Protein

Protein accession
8LJ0f [EnVhog]
Representative
7o4rq
Source
EnVhog (cluster: phalp2_34094)
Protein name
8LJ0f
Lysin probability
99%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
MKLKGILFGALATIGLFAGMQTANAYEVNNEFNLSPWEGSGQVAVPNKIILHETANERATGRNEATYMKNNWFNAHTTAIVGDGGIVYKIAPEGNISWGAGNANPYAPIQIELQHTHDKELFKKNYKAYIDYTRDMGKKFGIPMTLDQGSSVWEKGVISHKWVSDYVWGDHTDPYGYLAEMGISKAQLAKDLANGVGGNTATPTPKPNKPTQPKPAQPSKPSDKKRFNYRVDGLEYVNGMWQIYNEHLGKIDFNWTDNGIPVEVVDKVNPATGQPTKDQVLKVGDYFNFQENSTGVVQEQTPYNGYTLSHVQLPEEFIWLFTDSKQALMYQ
Physico‐chemical
properties
protein length:331 AA
molecular weight:36961,1 Da
isoelectric point:6,08
hydropathy:-0,57
Representative Protein Details
Accession
7o4rq
Protein name
7o4rq
Sequence length
378 AA
Molecular weight
42102,59680 Da
Isoelectric point
7,73928
Sequence
MKKFSKFLLSLIVVTGLLLPLPAAAYTVEQDPIQFSYHPGYASNEIIVLHEAGNPNNVGLNSLDNETAYMKRNWQNAYVSYFVGSGGRVKQLAPNGYYQYGAGAIGNSKAFAQIELSRTNNAAIFKKDYAAYVNLTRDLAKQAGFTFDLDDATPYGIKTHEWITNNWWGDHTDPYGYLAQWGISKSRLAQDLMNGLPEDGSETIVKPNKPNTPKYKVGQNIRFTTIYNSPDDPNEKHINANQKWTQVGTITRKLDGRKNLYEVKNTGKLLGYVNDGDIAEVLTPSQPITPSKPEQPHLVKMNGTFTTNQSLPVSRDTTVASPALAWYAPYEAIVYDGYAQSAGYVWISYIDYGGTRRYVAVGPDDGRIDTTWGRGFFN
Other Proteins in cluster: phalp2_34094
Total (incl. this protein): 142 Avg length: 365,6 Avg pI: 7,18

Protein ID Length (AA) pI
7o4rq 378 7,73928
11B7Q 365 7,77230
1byhg 364 9,79734
1dscc 368 6,22980
1eovJ 374 5,88996
1k9Eg 368 6,22850
1kWgL 307 8,89582
1nS5u 374 5,98807
1o4hg 368 7,72609
2dgq9 333 6,96774
2lZkP 368 7,75815
3jNoF 368 7,76315
3kzNM 366 6,91301
3lvRH 367 6,45085
5HIFJ 386 9,24962
5KSez 327 5,91543
5PCme 368 6,97115
5Yywp 368 7,72609
5tTe4 385 9,15343
63ST7 361 5,86552
64rsO 365 8,36208
65PCH 327 6,07338
671M0 365 8,36060
67pWq 324 6,14079
6cItq 365 7,78915
6eafE 328 6,66371
6ewQn 366 8,37381
6lKlt 387 9,02269
6nyxT 368 6,97059
6ojG0 361 7,76952
6t0Tv 361 6,97462
6uW5p 361 6,53094
6uzgf 361 6,97360
71UJx 440 8,99890
722jT 365 6,08413
72gVU 368 6,97115
72np5 365 5,64902
72sCQ 453 8,78551
73ZHf 368 6,52753
73ZKg 361 8,74947
73ZxS 368 6,97127
73f5q 375 6,53020
73f75 368 6,45261
73fej 367 8,37298
74AGQ 367 5,99659
74ArO 366 6,08907
74BcS 368 6,44130
74Bj6 363 8,42997
74ebi 375 8,90471
74edt 386 9,01463
751hR 368 6,53031
755Ld 368 6,31603
755Sb 366 6,23151
755Tc 366 6,23151
75XNe 361 7,02362
75knW 386 5,77731
76KEt 368 6,22850
76KGi 366 5,99136
76WLW 361 6,97104
76WW4 368 8,31824
76X8r 368 6,22980
76XIf 368 6,31603
76aIQ 367 8,39161
76e8c 361 6,97462
76en4 368 6,53315
76ezy 361 7,80978
76f9n 368 6,22895
76fTb 366 6,23151
76fWO 360 7,76940
76g7e 368 6,60176
76kKc 368 6,60176
76upT 367 5,98909
76uvg 361 8,43151
76vt7 368 6,31609
76vtp 368 6,97059
76vvf 361 6,44346
78KVO 360 5,72172
78LIH 368 6,31603
78Mnu 368 6,53128
78Nk9 367 6,08526
78PM7 349 8,83528
7A4zJ 365 7,77677
7A7NS 327 5,66136
7AgZG 328 6,24674
7AhRp 365 8,36060
7BO7p 322 6,59687
7BRua 367 6,22719
7BzH5 374 5,81744
7BzTA 374 5,98807
7C5DV 311 9,00219
7KwAS 365 5,39268
7PCQ0 328 6,07105
7PD1H 328 5,76077
7QFoy 367 6,24549
7Qz5a 368 6,60216
7X8p6 363 8,41095
7Ynpc 366 8,33546
7b94H 361 7,76912
7c6EO 368 6,60176
7c6FQ 367 6,66064
7eGFH 305 6,07844
7fZwu 308 9,11172
7fZxA 313 9,45688
7fdfO 386 8,93591
7hz05 378 5,91276
7iQO3 385 8,84115
7iQOV 388 8,52615
7jC7B 328 6,06713
7mBGK 449 9,74525
7mHtX 368 6,60176
7o4ql 378 6,32052
7s9n1 414 9,61909
7spQN 415 9,57041
7spQl 442 9,17084
7tiGI 368 5,98528
7u36h 366 5,56280
7uL4K 368 6,96649
7uYNv 361 6,97479
7uxB7 368 6,52741
7wcGZ 443 9,29906
7wcHx 440 8,99896
7xJYA 368 6,97098
85YlT 365 7,76809
85Yn9 365 8,37813
89vDo 328 6,24498
8IpqH 368 6,08907
8IpqM 365 8,36060
8IprL 365 8,36060
8LDZK 387 8,42526
8LDha 380 5,69501
8a8Ff 328 7,06170
8dTRq 366 6,97059
8eAin 366 6,38776
8lQFq 324 6,30699
8lket 367 6,22980
8olUA 324 6,30944
8omrV 378 9,31118
CRvq 365 8,36060
A0A1D3SNQ1 380 5,69501
A0A6G9LP24 380 5,52580
A0A8S5N634 361 8,72613
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_2709
7eGGb
22 33,7% 364 2.506E-96
2 phalp2_10019
74ect
1 32,6% 248 6.195E-59
3 phalp2_22264
7pxLN
64 22,6% 336 8.682E-22
4 phalp2_558
HtN7
28 26,3% 345 1.220E-20
5 phalp2_5901
5Lu6c
99 23,2% 352 1.356E-16
6 phalp2_22268
7qxva
11 20,3% 358 3.237E-15
7 phalp2_34516
4NLdN
4 20,4% 289 1.295E-11

Domains

Domains
Disordered region
Ami2
SH3_5
Representative sequence (used for alignment): 7o4rq (378 AA)
Member sequence: 8LJ0f (331 AA)
1 378 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF01510, PF08460

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (7o4rq) rather than this protein.
PDB ID
7o4rq
Method AlphaFoldv2
Resolution 83.79
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50