Protein
- Protein accession
- 8FynQ [EnVhog]
- Representative
- 20gBP
- Source
- EnVhog (cluster: phalp2_28477)
- Protein name
- 8FynQ
- Lysin probability
- 97%
- PhaLP type
-
VAL
Probability: 99% (predicted by ML model) - Protein sequence
-
ngnlsemssggssylsggdvsvdgariylnkgamgivsagavvgfdvpdeiqmtsrnaavvinevgsrgafdeegetipedwpdeeseasvlepteiltpatpaaeiteaceiieeidynyqlsnnftigdlsikavfphtvkaqgsfdlsgivcnmkhlclnileplvsqfpnirinsgfrtgsgssqhergqavdiqvpgfsaadysdmaswvvanlpvdqfilehgksvwlhisydrtrttqrgslltyypqsspayksglknyydngriit
- Physico‐chemical
properties -
protein length: 275 AA molecular weight: 29756,7 Da isoelectric point: 4,48 hydropathy: -0,21
Representative Protein Details
- Accession
- 20gBP
- Protein name
- 20gBP
- Sequence length
- 301 AA
- Molecular weight
- 31598,92080 Da
- Isoelectric point
- 5,58298
- Sequence
-
MSSQPWITDGKPQQSSTSPDVTGLYKSNGVFINGVNVVLYDTPGDSSAGAPSIPAAEAAVESQDDAMVEATPAQVAAQTQALVASGAITQEEADRGLAAANDPTATVDNTPSTYSGKGKNVDCSKFHSMSSFSAGVVLTPNGTTIGKMMVQSPHTIAAQHGLTADQIVCNLANLASNIYEPLKAQYPNCIVGNSFRPGGGLNASGKISQHEYGMAGDFKFRGMSKGDYIKVAQWVKNNLPFDQLIMENSPKGDLWVHVSYYSGGLGPHKNGAIGNMVDGLHYQPGLRDLSTISYVRQVPTA
Other Proteins in cluster: phalp2_28477
| Total (incl. this protein): 137 | Avg length: 320,2 | Avg pI: 7,33 |
|
|
||
| Protein ID | Length (AA) | pI |
|---|---|---|
| 20gBP | 301 | 5,58298 |
| 12RGl | 279 | 6,20201 |
| 15pSr | 330 | 9,03893 |
| 16nsP | 302 | 5,50147 |
| 17VgX | 289 | 8,75695 |
| 17Y4A | 327 | 9,23356 |
| 182d9 | 342 | 9,16935 |
| 184Xl | 331 | 8,47181 |
| 187vp | 281 | 6,99594 |
| 1ADkD | 332 | 6,59272 |
| 1AEwd | 344 | 5,62958 |
| 1AMRT | 330 | 9,07949 |
| 1Jtdh | 324 | 8,67456 |
| 1O5Dm | 321 | 8,08725 |
| 1OAvI | 324 | 6,75619 |
| 1QHLY | 347 | 5,45424 |
| 1ZwGc | 370 | 5,26081 |
| 1evtB | 329 | 7,05891 |
| 1eyAW | 327 | 5,23330 |
| 1eyfh | 375 | 6,59545 |
| 1iM6h | 323 | 5,97147 |
| 1iyjZ | 324 | 7,14207 |
| 1oyS8 | 259 | 6,05076 |
| 1zAgD | 340 | 6,13846 |
| 20qJe | 300 | 4,73494 |
| 25sVH | 330 | 7,93756 |
| 25wQy | 321 | 9,22106 |
| 27CCc | 352 | 5,01106 |
| 2YFMu | 322 | 9,35477 |
| 2ZD62 | 350 | 5,54012 |
| 2bGMP | 303 | 5,85438 |
| 2bwC9 | 296 | 5,28810 |
| 2jbUn | 291 | 8,56825 |
| 2lHQ3 | 323 | 6,18996 |
| 2p3QV | 327 | 5,87882 |
| 2rffq | 327 | 8,44628 |
| 2rgwT | 327 | 5,88547 |
| 2rk7R | 334 | 8,50817 |
| 30SkB | 279 | 6,22906 |
| 318cE | 293 | 8,55935 |
| 31Le4 | 331 | 8,91148 |
| 31OXJ | 330 | 8,80943 |
| 32UXr | 330 | 8,79847 |
| 32rzx | 324 | 8,78641 |
| 33DK8 | 338 | 9,05950 |
| 33w3e | 333 | 8,98536 |
| 342PG | 336 | 6,65269 |
| 34xd5 | 342 | 5,01561 |
| 35R7G | 324 | 7,17225 |
| 36RJL | 342 | 9,01444 |
| 3drPS | 324 | 8,71298 |
| 3erlN | 264 | 6,99582 |
| 3jD4W | 324 | 5,17089 |
| 43t2M | 333 | 8,98536 |
| 46E3R | 337 | 9,04616 |
| 46TVG | 332 | 7,87212 |
| 46UhT | 330 | 7,09552 |
| 46dMX | 293 | 5,58497 |
| 46t3i | 326 | 7,74161 |
| 46yQT | 326 | 8,35267 |
| 477Dn | 343 | 9,02952 |
| 47CMq | 337 | 7,76429 |
| 47ZIc | 294 | 5,75940 |
| 47iLg | 354 | 4,72999 |
| 47p4l | 293 | 5,69148 |
| 47wvK | 326 | 8,66192 |
| 482Nt | 305 | 4,73249 |
| 48iCl | 281 | 6,57607 |
| 495go | 277 | 6,70748 |
| 497nC | 396 | 5,17004 |
| 49nLi | 343 | 8,52454 |
| 4CfPq | 335 | 6,70555 |
| 4IZYA | 342 | 9,01482 |
| 4Rr65 | 330 | 7,87728 |
| 4YF7r | 329 | 4,93518 |
| 4a8NW | 324 | 8,96086 |
| 4aMFk | 328 | 5,55888 |
| 4aORI | 331 | 8,69248 |
| 4anXJ | 317 | 9,11494 |
| 4b53K | 332 | 8,92425 |
| 4bQFF | 293 | 8,76739 |
| 4bV1w | 335 | 7,76861 |
| 4eUup | 279 | 8,84372 |
| 4l64I | 329 | 7,13315 |
| 4ln6m | 394 | 7,06846 |
| 4p91z | 321 | 8,65264 |
| 4p9uK | 333 | 9,06724 |
| 4pTJ6 | 324 | 8,65483 |
| 4r5Cg | 297 | 5,86700 |
| 4rlbV | 292 | 8,76668 |
| 4xSvt | 291 | 8,36943 |
| 54DGa | 333 | 9,06724 |
| 54RPP | 324 | 5,06966 |
| 54Wpb | 280 | 7,63992 |
| 54aK3 | 319 | 6,74926 |
| 5BwbY | 329 | 7,15179 |
| 5E3AN | 324 | 5,70194 |
| 5bE6R | 330 | 7,93762 |
| 5bE8X | 330 | 8,96557 |
| 5bUEV | 326 | 9,08142 |
| 5d8Yq | 394 | 5,96641 |
| 5dls3 | 330 | 9,27740 |
| 5ePmb | 330 | 8,98098 |
| 5gz1C | 279 | 8,30632 |
| 5h1q1 | 324 | 5,76452 |
| 5kxGG | 289 | 5,94885 |
| 5oO4n | 318 | 4,70766 |
| 5vBoI | 319 | 6,70225 |
| 5w9Ub | 330 | 8,96557 |
| 5wSPh | 327 | 8,98033 |
| 5wu5z | 319 | 7,13343 |
| 6GkkP | 298 | 7,91609 |
| 6Glvg | 330 | 8,37104 |
| 6Hidn | 285 | 7,92234 |
| 6HjOu | 366 | 5,65624 |
| 6Mowc | 289 | 5,70251 |
| 6Mqn9 | 317 | 7,93079 |
| 6SOw1 | 281 | 6,99542 |
| 6Y7gK | 338 | 9,03765 |
| 6Zsp | 278 | 5,74144 |
| 87eDb | 330 | 9,11469 |
| 87fT3 | 287 | 5,92770 |
| 884wW | 345 | 4,98764 |
| 8bOkZ | 327 | 6,13466 |
| GUTr | 321 | 9,22106 |
| Hebn | 328 | 5,47646 |
| IPTg | 250 | 9,52097 |
| RTYz | 293 | 8,75766 |
| S6s0 | 279 | 7,00202 |
| SDXP | 331 | 7,83183 |
| SFE1 | 344 | 5,29378 |
| c7oP | 330 | 8,65503 |
| hYHP | 298 | 9,15723 |
| iXG8 | 330 | 6,65502 |
| jMb4 | 318 | 9,33555 |
| mHay | 295 | 5,18937 |
Similar Clusters (pHMM search)
| # | Cluster | # Members | Identity (%) | Alignment Length | E-value |
|---|---|---|---|---|---|
| 1 |
phalp2_16662
jD9v
|
47 | 28,9% | 307 | 6.436E-58 |
| 2 |
phalp2_2316
4Jcsj
|
9 | 27,9% | 286 | 5.954E-47 |
| 3 |
phalp2_14146
2itJA
|
5 | 25,8% | 201 | 3.095E-19 |
| 4 |
phalp2_36519
1pSbw
|
5 | 27,3% | 194 | 1.625E-16 |
Domains
Domains
1
301 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend:
EAD
CBD
Linker
Disordered
Unannotated
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Unknown from Metagenome [NCBI] |
UNKNOWN_ENVHOG | No lineage information |
| Host | No host information | ||
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
No Gene Ontology terms available.
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
No tertiary structures available for this protein.
The structures below correspond to the cluster representative
(20gBP)
rather than this protein.
Model Confidence
Very high
pLDDT > 90
pLDDT > 90
High
90 > pLDDT > 70
90 > pLDDT > 70
Low
70 > pLDDT > 50
70 > pLDDT > 50
Very low
pLDDT < 50
pLDDT < 50