Protein

Protein accession
8EM1K [EnVhog]
Representative
3Vmff
Source
EnVhog (cluster: phalp2_31742)
Protein name
8EM1K
Lysin probability
99%
PhaLP type
endolysin
Probability: 98% (predicted by ML model)
Protein sequence
mpfklsqrsfqklvdvhedlvetvkraieltkidfgviygvrslaeqeklfnsgrsqtmkskhliqedgkahavdlmayqdgepcweiqvydeiadamkeaavrtdtkirwgaawqiddlrdwegtaeeamnayidlrrsqgrrpfidgphfekn
Physico‐chemical
properties
protein length:155 AA
molecular weight:17917,0 Da
isoelectric point:5,27
hydropathy:-0,64
Representative Protein Details
Accession
3Vmff
Protein name
3Vmff
Sequence length
77 AA
Molecular weight
8952,97730 Da
Isoelectric point
5,08370
Sequence
VNSRASWELNLYDDLADAIKEAAIIVGVPIRWGAAWHIDDIRKWEGTMEEAMNAYIDLRRSQGRRPFIDGPHFEIRE
Other Proteins in cluster: phalp2_31742
Total (incl. this protein): 206 Avg length: 89,1 Avg pI: 5,16

Protein ID Length (AA) pI
3Vmff 77 5,08370
126ky 100 6,21468
12lkQ 165 5,94049
13Swr 124 4,78660
14htT 68 4,76876
1Agua 59 4,41835
1Auc1 116 4,68304
1Axuv 109 5,03897
1CeCs 93 4,36099
1ESvg 71 4,38532
1FaU6 109 4,89301
1PERT 61 6,07281
1SncI 99 7,18896
1UM9F 94 5,19107
1Ultw 94 4,66724
1W7EX 157 6,09453
1fj8C 94 5,47322
1fqyH 101 6,05667
1gdyL 135 4,91415
1rzzg 57 4,99799
1tDkF 82 4,35213
1tGSU 60 6,07588
1td14 73 4,58244
1xCfK 69 5,33340
229Ng 54 4,83594
26CN6 94 6,36269
29nlN 68 4,63752
2IsO3 89 6,44824
2J3uK 61 7,01822
2JY6Q 92 5,42951
2MMgK 76 5,18391
2MU2a 85 4,37435
2MxJf 94 5,05835
2OHMH 56 6,98633
2PjPU 73 4,99071
2Rep1 99 5,12866
2Rwbo 67 4,36639
2THIy 85 4,60409
2TkuA 72 4,60330
2XzFv 60 5,13742
2dOQA 59 5,11127
2fTdY 71 4,46075
2idI6 73 4,19565
2kxI5 59 5,11127
2lbRP 59 5,11127
2s7vo 81 4,40595
2u8Nk 96 5,25860
2uFTw 57 5,67852
2uLlx 112 4,80872
2uO3W 104 5,50653
2uUA7 151 5,42354
2xPjw 172 6,36235
2xf20 67 5,11127
2zdSD 64 5,10496
31g7W 68 4,53594
36roZ 98 5,86490
36tBS 96 5,53239
3CrRg 79 4,63649
3DDMO 90 6,44659
3DIvR 77 4,58613
3DzKT 93 4,79081
3E3jE 70 4,33923
3EIis 93 4,55953
3ETOT 98 4,44227
3EdER 77 5,13418
3EwkQ 56 9,68852
3F1Ti 76 4,57960
3F8s2 99 4,83452
3FCTl 90 4,65650
3FErV 80 4,33269
3FWwM 90 5,43156
3FoBh 79 4,61046
3FyGM 79 4,60733
3H8Ml 160 6,83480
3HxXr 97 4,74943
3ISzw 76 4,39481
3Jx5l 80 4,89085
3K8Yo 140 4,80712
3K8cm 90 5,86166
3KJVC 68 6,05724
3KqRY 84 4,41300
3L97L 59 5,43883
3LgeD 138 5,00532
3QryG 100 5,86609
3RHFw 61 5,06898
3RKE6 86 4,43153
3SVEM 108 4,80667
3Yg83 53 6,08191
3Zlf3 62 9,22937
3gEaK 97 5,29520
3hKw5 93 5,38478
3ohJQ 155 5,01254
3rDjQ 195 8,70454
40PdP 96 5,17879
41BN8 83 4,34957
42sR1 69 4,71811
438DM 81 5,90463
48qj2 74 4,74022
4RIQ5 79 5,15219
4UOQZ 65 4,84918
4V33T 58 6,02268
4WVal 52 5,60651
4XDjM 72 4,28381
4Xbv9 72 4,52253
4c6L2 65 5,44071
4jp7K 58 5,44867
4jpCW 89 4,37600
4qX2k 92 5,05676
4sHf5 78 4,55504
4sHie 91 4,95866
4sUl6 93 4,83702
4tdss 92 4,76512
4v4KD 53 5,65823
5HzF4 106 9,15988
5oBbM 176 8,66418
5oEO4 93 5,22034
5oRhv 142 4,83407
5p3J0 79 4,36617
5p9l8 66 4,79166
5pG8i 82 4,82400
5pN4Q 92 4,98753
5ptVY 92 4,68606
5qIUD 142 4,87317
5qdqy 131 5,38233
5qmo3 128 5,13889
5qnzR 99 4,69771
5rkhT 135 5,33897
5rugM 66 4,81360
6BisZ 98 4,46723
6KBt3 92 4,94604
6NIxS 98 4,46529
75n8q 73 4,52713
7CM1R 93 4,63871
7CnfC 97 5,05352
7CoCZ 69 4,46711
7CoCm 75 4,67043
7Cpd2 66 4,64843
7CxRZ 101 4,66724
7ET0m 64 6,78194
7EbGk 93 4,71749
7EnBu 71 4,52088
7HrcO 89 4,63547
7HzwA 74 4,74142
7ISC4 106 5,05136
7U0q4 68 4,74028
7VTHZ 99 4,80792
7VbCq 114 8,76095
7rW0J 103 4,68606
80UmZ 160 6,83542
80XnG 82 6,24737
836Q5 66 4,14415
836Uo 98 4,97781
83aIm 63 4,74938
8A4em 155 4,95883
8A6sa 65 5,63612
8BFXn 106 5,54245
8Bcz4 104 4,71232
8C1in 79 4,35196
8C8AQ 69 4,82497
8CJ9m 103 5,53375
8CYu5 99 5,87445
8CdmU 92 4,71783
8D31Q 155 5,12497
8DPjM 72 4,83708
8DwHT 73 4,32172
8EFyY 73 5,11167
8Eogn 82 4,73113
8Eu1s 71 4,71732
8FESf 79 4,57835
8FFBe 100 5,25394
8FPMc 78 5,17993
8Frf0 82 4,36736
8G3y7 77 4,84623
8G83w 114 5,19636
8GuOt 73 4,96792
8Gxyp 95 4,47405
8keVC 107 4,75733
8leWx 78 4,63564
8yHOk 92 4,69288
8yc6W 65 5,08239
8ygdT 86 4,63268
8zY7q 117 5,41297
8zjDA 56 6,06605
8znlb 155 5,38552
AIgz 92 4,98980
Bhie 101 4,99691
Ifm2 87 4,45580
WKWr 79 4,57369
Wm3U 65 4,70754
XInW 76 4,62927
XeO8 65 4,68242
dYsW 92 4,74204
e4Pc 75 4,67082
ldCj 58 4,41835
nWcf 91 4,76870
rJYr 52 5,57462
rOOH 74 4,46939
sV2e 57 5,70058
sZeY 94 4,37174
uS8U 69 4,88528
uu3H 93 4,51759
vLfh 100 5,09780
vPWQ 85 4,60409
vdED 100 5,88701
vseJ 89 4,84731
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_10760
3BKhW
56 86,0% 50 2.753E-29
2 phalp2_20976
7wh8L
317 32,0% 75 2.116E-14
3 phalp2_7690
6GwWY
1 31,1% 61 1.006E-04

Domains

Domains
Unannotated
Representative sequence (used for alignment): 3Vmff (77 AA)
Member sequence: 8EM1K (155 AA)
1 77 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (3Vmff) rather than this protein.
PDB ID
3Vmff
Method AlphaFoldv2
Resolution 94.89
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50