Protein

Protein accession
8E3Ee [EnVhog]
Representative
5lEwY
Source
EnVhog (cluster: phalp2_30515)
Protein name
8E3Ee
Lysin probability
98%
PhaLP type
endolysin
Probability: 99% (predicted by ML model)
Protein sequence
msfqdafvqllgheghysnlvtdkggetawglskrsypsldmktltmneagaiykrdfwdklgcdefvseklafqvfdaavnsgifqvtkwlqrsvnthadgilgpdtmnamklydestilarfnghrlqficelgnfaifgrgwarriaknlkea
Physico‐chemical
properties
protein length:156 AA
molecular weight:17605,8 Da
isoelectric point:6,90
hydropathy:-0,27
Representative Protein Details
Accession
5lEwY
Protein name
5lEwY
Sequence length
165 AA
Molecular weight
18014,20470 Da
Isoelectric point
5,30424
Sequence
MDFVFDAEGGFVDDSRDAGGMTNMGISAASHSDLDIRGLTRENALTVYRDCYWGPSGASKLPWPANVAVLDYAVHSGTRRAVEALQTVVNSVSDGVFGPKTDDACKTYLVSKTPVDLANAVTNLRGQFLAQLCLMPKFKCYANGWTNRLERLKMLVNQEDTLQCP
Other Proteins in cluster: phalp2_30515
Total (incl. this protein): 188 Avg length: 166,9 Avg pI: 7,63

Protein ID Length (AA) pI
5lEwY 165 5,30424
12I09 174 6,28954
15acO 158 9,14698
17Oqe 161 7,59206
1G8QD 157 8,52738
1GAtp 166 8,80543
1I2oN 159 6,51212
1IdXc 154 9,18360
1LdIZ 161 6,82531
1MrKd 160 9,18489
1PVid 155 9,29790
1Wyoj 158 9,19766
1X5eN 158 9,04345
1Xw47 172 5,46776
1aF0Y 157 9,51478
1fCY5 168 6,61659
1gxTJ 173 9,89920
1h9hW 166 9,16845
1j4xO 179 9,25826
1pESF 158 9,09476
1plbw 158 8,07636
1yDGC 158 9,44251
20C2o 174 7,74081
21bMv 158 8,00802
27GRO 178 5,96829
2FDUX 156 5,39706
2RfPq 158 8,68191
2SbCs 182 5,06654
2ZBic 175 5,59969
2ZEjA 175 6,41385
2aqeM 187 6,04184
2hN2T 161 5,86780
2hVDp 163 8,38819
2jjyY 174 5,40848
2ti9f 176 5,47691
2wOlP 174 9,82603
308xw 174 8,43699
30LFX 174 8,43699
30MEz 181 8,17132
30bbL 174 5,36818
30vNq 164 7,64845
31cN9 174 6,41317
342gW 158 8,95397
342vt 157 9,29545
35djp 162 8,70918
35f1Z 162 8,88511
37sOr 162 5,89798
38aG9 180 6,31796
38elS 181 5,71228
3Ne0D 167 4,64269
3XHrP 158 9,44393
3bZlZ 173 9,78715
3behx 174 6,41373
3c0gS 173 9,78844
3dLyk 174 9,98346
3dM9x 174 9,78722
3zn0Y 188 4,56346
46CxY 189 6,09316
46Xo7 180 7,65646
46abs 178 6,12863
46t8P 163 6,64791
479ER 176 5,53853
47Js9 178 6,30904
47Jx4 174 5,91378
47u7R 163 6,56993
484Wn 175 6,89840
48Fnh 178 6,30239
48Xm3 189 5,62242
4AdYa 156 6,83628
4GBPE 158 9,51349
4HJeD 198 6,32006
4Jsdp 145 5,81414
4NQMq 158 8,73452
4NnAB 157 9,06569
4UqcN 212 5,99068
4ZGRj 179 5,50573
4bLNh 181 8,17454
4bQCO 163 8,42378
4bfsr 158 6,73988
4bqMk 157 9,25581
4cPGJ 163 6,56993
4eSv0 188 6,22776
4fzmP 182 5,69933
4lPKZ 158 6,74539
4lfFV 158 9,14763
4pfaD 178 7,66709
4rWOY 172 5,15384
4zROB 157 8,61692
4zRxq 158 9,04255
4zZ92 158 6,13340
4zvgv 158 9,04255
50YwS 158 9,04255
52Lja 158 9,09270
52O8F 158 9,04345
559Lr 174 7,67908
55Wt1 158 9,19766
56NCA 180 5,68091
56V9K 158 9,04255
57Ff5 158 9,04345
599kj 180 5,95328
59Gwd 158 9,19766
59Iaa 161 8,75766
5ADCU 158 9,19766
5Bjib 165 5,30424
5aQzw 158 8,99774
5abqe 158 9,19766
5aeGN 158 8,04464
5aydK 120 5,50647
5bW6Y 158 9,04255
5ct1A 158 6,74346
5dYuO 158 8,68197
5fnNS 158 9,04255
5fsWD 158 8,02620
5fwxi 158 8,04496
5ie07 158 9,19766
5iloM 158 8,88440
5lIy0 158 9,21107
5lnrl 157 9,18450
5mmlE 158 9,09476
5mou9 210 6,36690
5olrO 158 9,04255
5qMla 169 5,75213
5rfY6 172 6,59852
5tO7b 178 5,96829
5v4LF 178 5,67756
5xVGQ 177 8,94707
5xdLj 160 8,13909
6Fzvu 217 6,51013
6GfUc 178 5,52023
6KVsD 158 8,04973
6MqCh 162 7,61667
6PFVe 173 9,85440
6PG1h 173 9,71237
6PJdv 173 9,55410
6QsAY 180 5,17266
6TGKl 173 9,50872
6TpDE 161 6,29977
6U055 159 8,85797
6W2Ie 155 7,87767
6WJyR 162 7,12269
6WMML 159 6,83525
6x6Lc 159 6,73919
6xe6V 158 9,43451
6xqEL 158 8,05018
6zHgI 161 8,96151
6zrWk 158 9,04345
71N60 173 9,50646
7XeZ3 162 6,72879
7jT1R 173 9,63701
7jTUv 162 8,68429
7xE6x 162 9,29184
7xbK 185 5,22319
819Yz 158 8,78532
84Evp 179 5,87581
84Mrb 157 8,52731
85Njf 199 9,61793
87vDH 158 9,33098
89zwq 157 9,43013
8Dcbm 156 6,41237
8ah63 176 7,74093
8e9PQ 158 7,78631
8jHgi 158 8,04490
8kA7h 172 5,97602
8nxsj 164 8,92618
8oKcz 174 7,88199
8qnJ5 180 6,40527
8sAt7 159 9,24517
8x3vc 171 5,97602
99ML 160 6,91170
FQ85 178 7,66181
G9P4 149 5,49704
GzF1 158 9,56467
HhIm 180 5,67756
HhSU 180 5,95135
J8Mv 178 6,42669
KYx3 180 5,68006
PTQD 171 5,15526
Q6RQ 163 8,39902
Qyvm 158 9,12661
SvR4 175 7,72473
Z00D 177 9,64146
aQLD 170 6,03178
hbWg 158 9,33923
jVXX 158 8,95887
lF9n 157 5,02675
mGZT 125 6,16148
y4A5 178 5,84978
Similar Clusters (pHMM search)
# Cluster # Members Identity (%) Alignment Length E-value
1 phalp2_25028
ZsUq
3460 38,6% 150 5.632E-65
2 phalp2_23908
1Le4q
257 35,7% 165 3.403E-63
3 phalp2_23756
YFA5
85 36,6% 150 4.383E-59
4 phalp2_20698
4XKIk
408 31,4% 162 6.008E-59
5 phalp2_37851
4LyyS
5845 35,8% 162 9.343E-57
6 phalp2_12946
360Ik
1926 32,9% 158 2.729E-54
7 phalp2_20
4NbzH
79 31,1% 167 1.695E-49
8 phalp2_12184
6C2VC
988 36,8% 163 1.540E-48
9 phalp2_13836
7fGjh
493 35,0% 157 1.582E-45
10 phalp2_1444
1DO8y
138 30,4% 171 1.582E-45

Domains

Domains
Representative sequence (used for alignment): 5lEwY (165 AA)
Member sequence: 8E3Ee (156 AA)
1 165 AA (representative)
Domain positions follow the representative sequence above; the member sequence bar is scaled to the same axis.
Legend: EAD CBD Linker Disordered Unannotated
Pfam accessions: PF05838

Taxonomy

  Name Taxonomy ID Lineage
Phage Unknown from Metagenome
[NCBI]
UNKNOWN_ENVHOG No lineage information
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

No Gene Ontology terms available.

Enzymatic activity

No enzymatic activity data available.

Tertiary structure

No tertiary structures available for this protein.

The structures below correspond to the cluster representative (5lEwY) rather than this protein.
PDB ID
5lEwY
Method AlphaFoldv2
Resolution 81.82
Chain position -
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50